chore(deps): update golang docker tag

chore(deps): update module github.com/go-git/go-git/v5 to v5.19.3
chore(deps): update otel/weaver docker tag to v0.27.0
2026-10-04 16:01:27 +00:00 · 2026-10-04 15:02:06 +00:00 · 2026-10-04 01:01:15 +00:00 · 2026-09-15 23:01:13 +00:00 · 2026-09-08 19:01:07 +00:00 · 2026-09-08 18:03:14 +00:00
329 changed files with 17681 additions and 31521 deletions
@@ -3,17 +3,22 @@ kind: pipeline
 name: coopcloud.tech/abra
 steps:
  - name: make check
-    image: golang:1.26
+    image: golang:1.27
    commands:
      - make check

  - name: xgettext-go
-    image: git.coopcloud.tech/toolshed/drone-xgettext-go:latest
-    settings:
-      keyword: i18n.G
-      keyword_ctx: i18n.GC
-      out: pkg/i18n/locales/abra.pot
-      comments_tag: translators
+    image: golang:1.27
+    environment:
+      GOPRIVATE: coopcloud.tech
+    commands:
+      - go run git.coopcloud.tech/toolshed/xgettext-go@latest
+        -o pkg/i18n/locales/abra.pot
+        --keyword=i18n.G
+        --keyword-ctx=i18n.GC
+        --sort-output
+        --add-comments-tag="translators"
+        $(find . -name "*.go" -not -path "*vendor*" | sort)
    depends_on:
      - make check
    when:
@@ -38,7 +43,7 @@ steps:
          - tag

  - name: make test
-    image: golang:1.26
+    image: golang:1.27
    environment:
      ABRA_DIR: /root/.abra_test
    commands:
@@ -0,0 +1 @@
+vendor/** linguist-generated=true
@@ -1,5 +1,5 @@
 # Build image
-FROM golang:1.26-alpine AS build
+FROM golang:1.27-alpine AS build

 ENV GOPRIVATE=coopcloud.tech

@@ -15,7 +15,7 @@ WORKDIR /app

 RUN CGO_ENABLED=0 make build

-FROM alpine:3.22
+FROM alpine:3.24

 RUN apk add --no-cache \
  ca-certificates \
@@ -1,5 +1,5 @@
 ABRA         := ./cmd/abra
-XGETTEXT     := ./bin/xgettext-go
+XGETTEXT     := go run git.coopcloud.tech/toolshed/xgettext-go@latest
 COMMIT       := $(shell git rev-list -1 HEAD)
 GOPATH       := $(shell go env GOPATH)
 GOVERSION    := 1.26
@@ -62,8 +62,8 @@ update-po:
 	done

 .PHONY: update-pot
-update-pot: $(XGETTEXT)
-	@${XGETTEXT} \
+update-pot:
+	@$(XGETTEXT) \
 		-o pkg/i18n/locales/$(DOMAIN).pot \
 		--keyword=i18n.G \
 		--keyword-ctx=i18n.GC \
@@ -71,11 +71,6 @@ update-pot: $(XGETTEXT)
 		--add-comments-tag="translators" \
 		$$(find . -name "*.go" -not -path "*vendor*" | sort)

-${XGETTEXT}:
-	@mkdir -p ./bin && \
-	wget -O ./bin/xgettext-go https://git.coopcloud.tech/toolshed/xgettext-go/raw/branch/main/xgettext-go && \
-	chmod +x ./bin/xgettext-go
-
 .PHONY: update-pot-po-metadata
 update-pot-po-metadata:
 	@sed -i "s/charset=CHARSET/charset=UTF-8/g" pkg/i18n/locales/*.po pkg/i18n/locales/*.pot
@@ -151,11 +151,12 @@ checkout as-is. Recipe commit hashes are also supported as values for

 		stackName := app.StackName()
 		deployOpts := stack.Deploy{
-			Composefiles: composeFiles,
-			Namespace:    stackName,
-			Prune:        false,
-			ResolveImage: stack.ResolveImageAlways,
-			Detach:       false,
+			Composefiles:     composeFiles,
+			Namespace:        stackName,
+			Prune:            false,
+			ResolveImage:     stack.ResolveImageAlways,
+			Detach:           false,
+			SendRegistryAuth: true,
 		}
 		compose, err := appPkg.GetAppComposeConfig(app.Name, deployOpts, app.Env)
 		if err != nil {
@@ -112,7 +112,11 @@ var AppNewCommand = &cobra.Command{
 				}
 			}

-			if len(recipeVersions) > 0 {
+			if recipeVersion != "" {
+				if _, err := recipe.EnsureVersion(recipeVersion); err != nil {
+					log.Fatal(err)
+				}
+			} else if len(recipeVersions) > 0 {
 				latest := recipeVersions[len(recipeVersions)-1]
 				for tag := range latest {
 					recipeVersion = tag
@@ -166,11 +166,12 @@ beforehand. See "abra app backup" for more.`),

 		stackName := app.StackName()
 		deployOpts := stack.Deploy{
-			Composefiles: composeFiles,
-			Namespace:    stackName,
-			Prune:        false,
-			ResolveImage: stack.ResolveImageAlways,
-			Detach:       false,
+			Composefiles:     composeFiles,
+			Namespace:        stackName,
+			Prune:            false,
+			ResolveImage:     stack.ResolveImageAlways,
+			Detach:           false,
+			SendRegistryAuth: true,
 		}

 		compose, err := appPkg.GetAppComposeConfig(app.Name, deployOpts, app.Env)
@@ -178,11 +178,12 @@ beforehand. See "abra app backup" for more.`),

 		stackName := app.StackName()
 		deployOpts := stack.Deploy{
-			Composefiles: composeFiles,
-			Namespace:    stackName,
-			Prune:        false,
-			ResolveImage: stack.ResolveImageAlways,
-			Detach:       false,
+			Composefiles:     composeFiles,
+			Namespace:        stackName,
+			Prune:            false,
+			ResolveImage:     stack.ResolveImageAlways,
+			Detach:           false,
+			SendRegistryAuth: true,
 		}

 		compose, err := appPkg.GetAppComposeConfig(app.Name, deployOpts, app.Env)
@@ -0,0 +1,61 @@
+{
+  "nodes": {
+    "flake-utils": {
+      "inputs": {
+        "systems": "systems"
+      },
+      "locked": {
+        "lastModified": 1731533236,
+        "narHash": "sha256-l0KFg5HjrsfsO/JpG+r7fRrqm12kzFHyUHqHCVpMMbI=",
+        "owner": "numtide",
+        "repo": "flake-utils",
+        "rev": "11707dc2f618dd54ca8739b309ec4fc024de578b",
+        "type": "github"
+      },
+      "original": {
+        "owner": "numtide",
+        "repo": "flake-utils",
+        "type": "github"
+      }
+    },
+    "nixpkgs": {
+      "locked": {
+        "lastModified": 1778443072,
+        "narHash": "sha256-zi7/fsqM/kFdNuED//4WOCUtezGtKKqRNORjMvfwjnA=",
+        "owner": "nixos",
+        "repo": "nixpkgs",
+        "rev": "da5ad661ba4e5ef59ba743f0d112cbc30e474f32",
+        "type": "github"
+      },
+      "original": {
+        "owner": "nixos",
+        "ref": "nixos-unstable",
+        "repo": "nixpkgs",
+        "type": "github"
+      }
+    },
+    "root": {
+      "inputs": {
+        "flake-utils": "flake-utils",
+        "nixpkgs": "nixpkgs"
+      }
+    },
+    "systems": {
+      "locked": {
+        "lastModified": 1681028828,
+        "narHash": "sha256-Vy1rq5AaRuLzOxct8nz4T6wlgyUR7zLU309k9mBC768=",
+        "owner": "nix-systems",
+        "repo": "default",
+        "rev": "da67096a3b9bf56a91d16901293e51ba5b49a27e",
+        "type": "github"
+      },
+      "original": {
+        "owner": "nix-systems",
+        "repo": "default",
+        "type": "github"
+      }
+    }
+  },
+  "root": "root",
+  "version": 7
+}
@@ -0,0 +1,37 @@
+{
+  description = "The Co-op Cloud utility belt";
+
+  inputs = {
+    nixpkgs.url = "github:nixos/nixpkgs?ref=nixos-unstable";
+    flake-utils.url = "github:numtide/flake-utils";
+  };
+
+  outputs =
+    {
+      self,
+      nixpkgs,
+      flake-utils,
+    }:
+    flake-utils.lib.eachDefaultSystem (
+      system:
+      let
+        pkgs = nixpkgs.legacyPackages.${system};
+      in
+      {
+        packages = rec {
+          abra = pkgs.callPackage ./package.nix { };
+          default = abra;
+        };
+        apps = rec {
+          abra = flake-utils.lib.mkApp { drv = self.packages.${system}.abra; };
+          default = abra;
+        };
+        devShells.default = pkgs.mkShell {
+          packages = with pkgs; [
+            go_1_26
+            gnumake
+          ];
+        };
+      }
+    );
+}
@@ -3,7 +3,7 @@ module coopcloud.tech/abra
 go 1.26.0

 require (
-	coopcloud.tech/tagcmp v0.0.0-20250818180036-0ec1b205b5ca
+	coopcloud.tech/tagcmp v0.0.0-20260515102403-c26951b55977
 	git.coopcloud.tech/toolshed/godotenv v1.5.2-0.20250103171850-4d0ca41daa5c
 	github.com/AlecAivazis/survey/v2 v2.3.7
 	github.com/charmbracelet/bubbletea v1.3.10
@@ -13,14 +13,14 @@ require (
 	github.com/docker/cli v28.4.0+incompatible
 	github.com/docker/docker v28.5.2+incompatible
 	github.com/docker/go-units v0.5.0
-	github.com/go-git/go-git/v5 v5.17.2
+	github.com/go-git/go-git/v5 v5.19.3
 	github.com/google/go-cmp v0.7.0
 	github.com/leonelquinteros/gotext v1.7.2
 	github.com/moby/sys/signal v0.7.1
 	github.com/moby/term v0.5.2
 	github.com/pkg/errors v0.9.1
-	github.com/schollz/progressbar/v3 v3.19.0
-	golang.org/x/term v0.41.0
+	github.com/schollz/progressbar/v3 v3.19.1
+	golang.org/x/term v0.46.0
 	gopkg.in/yaml.v3 v3.0.1
 	gotest.tools/v3 v3.5.2
 )
@@ -50,7 +50,6 @@ require (
 	github.com/containerd/platforms v0.2.1 // indirect
 	github.com/cpuguy83/go-md2man/v2 v2.0.7 // indirect
 	github.com/cyphar/filepath-securejoin v0.6.1 // indirect
-	github.com/davecgh/go-spew v1.1.1 // indirect
 	github.com/docker/distribution v2.8.3+incompatible // indirect
 	github.com/docker/go-connections v0.6.0 // indirect
 	github.com/docker/go-metrics v0.0.1 // indirect
@@ -60,7 +59,7 @@ require (
 	github.com/felixge/httpsnoop v1.0.4 // indirect
 	github.com/ghodss/yaml v1.0.0 // indirect
 	github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 // indirect
-	github.com/go-git/go-billy/v5 v5.8.0 // indirect
+	github.com/go-git/go-billy/v5 v5.9.2 // indirect
 	github.com/go-logfmt/logfmt v0.6.1 // indirect
 	github.com/go-logr/logr v1.4.3 // indirect
 	github.com/go-logr/stdr v1.2.2 // indirect
@@ -74,10 +73,9 @@ require (
 	github.com/kballard/go-shellquote v0.0.0-20180428030007-95032a82bc51 // indirect
 	github.com/kevinburke/ssh_config v1.6.0 // indirect
 	github.com/klauspost/compress v1.18.5 // indirect
-	github.com/klauspost/cpuid/v2 v2.3.0 // indirect
 	github.com/lucasb-eyer/go-colorful v1.4.0 // indirect
 	github.com/mattn/go-colorable v0.1.14 // indirect
-	github.com/mattn/go-isatty v0.0.20 // indirect
+	github.com/mattn/go-isatty v0.0.22 // indirect
 	github.com/mattn/go-localereader v0.0.1 // indirect
 	github.com/mattn/go-runewidth v0.0.21 // indirect
 	github.com/mgutz/ansi v0.0.0-20200706080929-d51e80ef957d // indirect
@@ -96,8 +94,7 @@ require (
 	github.com/opencontainers/go-digest v1.0.0 // indirect
 	github.com/opencontainers/runc v1.1.13 // indirect
 	github.com/opencontainers/runtime-spec v1.1.0 // indirect
-	github.com/pjbgf/sha1cd v0.5.0 // indirect
-	github.com/pmezard/go-difflib v1.0.0 // indirect
+	github.com/pjbgf/sha1cd v0.7.0 // indirect
 	github.com/prometheus/client_model v0.6.2 // indirect
 	github.com/prometheus/common v0.67.5 // indirect
 	github.com/prometheus/procfs v0.20.1 // indirect
@@ -123,11 +120,11 @@ require (
 	go.opentelemetry.io/otel/trace v1.42.0 // indirect
 	go.opentelemetry.io/proto/otlp v1.10.0 // indirect
 	go.yaml.in/yaml/v2 v2.4.4 // indirect
-	go.yaml.in/yaml/v3 v3.0.4 // indirect
-	golang.org/x/crypto v0.49.0 // indirect
-	golang.org/x/exp v0.0.0-20260312153236-7ab1446f8b90 // indirect
-	golang.org/x/net v0.52.0 // indirect
-	golang.org/x/text v0.35.0 // indirect
+	go.yaml.in/yaml/v3 v3.0.5 // indirect
+	golang.org/x/crypto v0.56.0 // indirect
+	golang.org/x/exp v0.0.0-20260410095643-746e56fc9e2f // indirect
+	golang.org/x/net v0.57.0 // indirect
+	golang.org/x/text v0.41.0 // indirect
 	golang.org/x/time v0.15.0 // indirect
 	google.golang.org/genproto/googleapis/api v0.0.0-20260401024825-9d38bb4040a9 // indirect
 	google.golang.org/genproto/googleapis/rpc v0.0.0-20260401024825-9d38bb4040a9 // indirect
@@ -152,12 +149,12 @@ require (
 	github.com/prometheus/client_golang v1.23.2 // indirect
 	github.com/sergi/go-diff v1.4.0 // indirect
 	github.com/spf13/cobra v1.10.1
-	github.com/stretchr/testify v1.11.1
+	github.com/stretchr/testify v1.12.1
 	github.com/theupdateframework/notary v0.7.0 // indirect
 	github.com/xeipuuv/gojsonpointer v0.0.0-20190905194746-02993c407bfb // indirect
-	golang.org/x/sys v0.42.0
+	golang.org/x/sys v0.48.0
 )

 replace github.com/docker/cli v28.4.0+incompatible => git.coopcloud.tech/toolshed/docker-cli v28.5.3-0.20260202112816-30df2d0b3a00+incompatible

-replace github.com/spf13/cobra => github.com/decentral1se/cobra v1.10.2-i18n
+replace github.com/spf13/cobra => github.com/decentral1se/cobra v1.10.2
@@ -22,8 +22,8 @@ cloud.google.com/go/pubsub v1.2.0/go.mod h1:jhfEVHT8odbXTkndysNHCcx0awwzvfOlguIA
 cloud.google.com/go/storage v1.0.0/go.mod h1:IhtSnM/ZTZV8YYJWCY8RULGVqBDmpoyjwiyrjsg+URw=
 cloud.google.com/go/storage v1.5.0/go.mod h1:tpKbwo567HUNpVclU5sGELwQWBDZ8gh0ZeosJ0Rtdos=
 cloud.google.com/go/storage v1.6.0/go.mod h1:N7U0C8pVQ/+NIKOBQyamJIeKQKkZ+mxpohlUTyfDhBk=
-coopcloud.tech/tagcmp v0.0.0-20250818180036-0ec1b205b5ca h1:gSD53tBAsbIGq4SnFfq+mEep6foekQ2a5ea7b38qkm0=
-coopcloud.tech/tagcmp v0.0.0-20250818180036-0ec1b205b5ca/go.mod h1:ESVm0wQKcbcFi06jItF3rI7enf4Jt2PvbkWpDDHk1DQ=
+coopcloud.tech/tagcmp v0.0.0-20260515102403-c26951b55977 h1:J7I0HFjwVAj/kkX6lwSTHmlXDRjQRsdIFNUUqu55ADY=
+coopcloud.tech/tagcmp v0.0.0-20260515102403-c26951b55977/go.mod h1:ESVm0wQKcbcFi06jItF3rI7enf4Jt2PvbkWpDDHk1DQ=
 dario.cat/mergo v1.0.2 h1:85+piFYR1tMbRrLcDwR18y4UKJ3aH1Tbzi24VRW1TK8=
 dario.cat/mergo v1.0.2/go.mod h1:E/hbnu0NxMFBjpMIE34DRGLWqDy0g5FuKDhCb31ngxA=
 dmitri.shuralyov.com/gpu/mtl v0.0.0-20190408044501-666a987793e9/go.mod h1:H6x//7gZCb22OMCxBHrMx7a5I7Hp++hsVxbQ4BYO7hU=
@@ -306,10 +306,9 @@ github.com/d2g/dhcp4client v1.0.0/go.mod h1:j0hNfjhrt2SxUOw55nL0ATM/z4Yt3t2Kd1mW
 github.com/d2g/dhcp4server v0.0.0-20181031114812-7d4a0a7f59a5/go.mod h1:Eo87+Kg/IX2hfWJfwxMzLyuSZyxSoAug2nGa1G2QAi8=
 github.com/d2g/hardwareaddr v0.0.0-20190221164911-e7d9fbe030e4/go.mod h1:bMl4RjIciD2oAxI7DmWRx6gbeqrkoLqv3MV0vzNad+I=
 github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
-github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c=
 github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
-github.com/decentral1se/cobra v1.10.2-i18n h1:XR+6AHHfnf4k5NM9f09oLMrEVwz3rkQIAIcqgL8R08g=
-github.com/decentral1se/cobra v1.10.2-i18n/go.mod h1:7C1pvHqHw5A4vrJfjNwvOdzYu0Gml16OCs2GRiTUUS4=
+github.com/decentral1se/cobra v1.10.2 h1:MZ8Ifi/jRels9sZrpSccDbUlK++3b2HlBODfv0Bh6x0=
+github.com/decentral1se/cobra v1.10.2/go.mod h1:7C1pvHqHw5A4vrJfjNwvOdzYu0Gml16OCs2GRiTUUS4=
 github.com/decentral1se/passgen v1.0.1 h1:j2AxK/kHKxDHWZZfkJj8Wgae9+O+DYEqR5sjKthIYKA=
 github.com/decentral1se/passgen v1.0.1/go.mod h1:530V+lNoPhKtkrX2fIVsIfLhkl47CuiOM7HRgi7C+SU=
 github.com/denisenkom/go-mssqldb v0.0.0-20191128021309-1d7a30a10f73/go.mod h1:xbL0rPBG9cCiLr28tMa8zpbdarY27NDyej4t/EjAShU=
@@ -389,12 +388,12 @@ github.com/gliderlabs/ssh v0.3.8 h1:a4YXD1V7xMF9g5nTkdfnja3Sxy1PVDCj1Zg4Wb8vY6c=
 github.com/gliderlabs/ssh v0.3.8/go.mod h1:xYoytBv1sV0aL3CavoDuJIQNURXkkfPA/wxQ1pL1fAU=
 github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 h1:+zs/tPmkDkHx3U66DAb0lQFJrpS6731Oaa12ikc+DiI=
 github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376/go.mod h1:an3vInlBmSxCcxctByoQdvwPiA7DTK7jaaFDBTtu0ic=
-github.com/go-git/go-billy/v5 v5.8.0 h1:I8hjc3LbBlXTtVuFNJuwYuMiHvQJDq1AT6u4DwDzZG0=
-github.com/go-git/go-billy/v5 v5.8.0/go.mod h1:RpvI/rw4Vr5QA+Z60c6d6LXH0rYJo0uD5SqfmrrheCY=
+github.com/go-git/go-billy/v5 v5.9.2 h1:OXFSRyz4g20upsGDJgQG9Bak1l/ZEv8GHVYB52O71sE=
+github.com/go-git/go-billy/v5 v5.9.2/go.mod h1:ExsU+jcGwXTBOnyilvAnEM1wug1IxHr4yP2ZXsNRtV0=
 github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399 h1:eMje31YglSBqCdIqdhKBW8lokaMrL3uTkpGYlE2OOT4=
 github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399/go.mod h1:1OCfN199q1Jm3HZlxleg+Dw/mwps2Wbk9frAWm+4FII=
-github.com/go-git/go-git/v5 v5.17.2 h1:B+nkdlxdYrvyFK4GPXVU8w1U+YkbsgciIR7f2sZJ104=
-github.com/go-git/go-git/v5 v5.17.2/go.mod h1:pW/VmeqkanRFqR6AljLcs7EA7FbZaN5MQqO7oZADXpo=
+github.com/go-git/go-git/v5 v5.19.3 h1:qHttbZ+Am7wEjdTpR1XMQ4rl42FK9SIXzZ4o9x7s6M4=
+github.com/go-git/go-git/v5 v5.19.3/go.mod h1:Ye4C8dVigkqrv9UsB4NMdSLV4yAIkLiIhW61gcOyhl4=
 github.com/go-gl/glfw v0.0.0-20190409004039-e6da0acd62b1/go.mod h1:vR7hzQXu2zJy9AVAgeJqvqgH9Q5CA+iKCZ2gyEVpxRU=
 github.com/go-gl/glfw/v3.3/glfw v0.0.0-20191125211704-12ad95a8df72/go.mod h1:tQ2UAYgL5IevRw8kRxooKSPJfGvJ9fJQFa0TUsXzTg8=
 github.com/go-gl/glfw/v3.3/glfw v0.0.0-20200222043503-6f7a984d4dc4/go.mod h1:tQ2UAYgL5IevRw8kRxooKSPJfGvJ9fJQFa0TUsXzTg8=
@@ -586,8 +585,6 @@ github.com/klauspost/compress v1.11.13/go.mod h1:aoV0uJVorq1K+umq18yTdKaF57EivdY
 github.com/klauspost/compress v1.14.2/go.mod h1:/3/Vjq9QcHkK5uEr5lBEmyoZ1iFhe47etQ6QUkpK6sk=
 github.com/klauspost/compress v1.18.5 h1:/h1gH5Ce+VWNLSWqPzOVn6XBO+vJbCNGvjoaGBFW2IE=
 github.com/klauspost/compress v1.18.5/go.mod h1:cwPg85FWrGar70rWktvGQj8/hthj3wpl0PGDogxkrSQ=
-github.com/klauspost/cpuid/v2 v2.3.0 h1:S4CRMLnYUhGeDFDqkGriYKdfoFlDnMtqTiI/sFzhA9Y=
-github.com/klauspost/cpuid/v2 v2.3.0/go.mod h1:hqwkgyIinND0mEev00jJYCxPNVRVXFQeu1XKlok6oO0=
 github.com/klauspost/pgzip v1.2.5/go.mod h1:Ch1tH69qFZu15pkjo5kYi6mth2Zzwzt50oCQKQE9RUs=
 github.com/konsorten/go-windows-terminal-sequences v1.0.1/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ=
 github.com/konsorten/go-windows-terminal-sequences v1.0.2/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ=
@@ -623,8 +620,8 @@ github.com/mattn/go-colorable v0.1.14 h1:9A9LHSqF/7dyVVX6g0U9cwm9pG3kP9gSzcuIPHP
 github.com/mattn/go-colorable v0.1.14/go.mod h1:6LmQG8QLFO4G5z1gPvYEzlUgJ2wF+stgPZH1UqBm1s8=
 github.com/mattn/go-isatty v0.0.4/go.mod h1:M+lRXTBqGeGNdLjl/ufCoiOlB5xdOkqRJdNxMWT7Zi4=
 github.com/mattn/go-isatty v0.0.8/go.mod h1:Iq45c/XA43vh69/j3iqttzPXn0bhXyGjM0Hdxcsrc5s=
-github.com/mattn/go-isatty v0.0.20 h1:xfD0iDuEKnDkl03q4limB+vH+GxLEtL/jb4xVJSWWEY=
-github.com/mattn/go-isatty v0.0.20/go.mod h1:W+V8PltTTMOvKvAeJH7IuucS94S2C6jfK/D7dTCTo3Y=
+github.com/mattn/go-isatty v0.0.22 h1:j8l17JJ9i6VGPUFUYoTUKPSgKe/83EYU2zBC7YNKMw4=
+github.com/mattn/go-isatty v0.0.22/go.mod h1:ZXfXG4SQHsB/w3ZeOYbR0PrPwLy+n6xiMrJlRFqopa4=
 github.com/mattn/go-localereader v0.0.1 h1:ygSAOl7ZXTx4RdPYinUpg6W99U8jWvWi9Ye2JC/oIi4=
 github.com/mattn/go-localereader v0.0.1/go.mod h1:8fBrzywKY7BI3czFoHkuzRoWE9C+EiG4R1k4Cjx5p88=
 github.com/mattn/go-runewidth v0.0.2/go.mod h1:LwmH8dsx7+W8Uxz3IHJYH5QSwggIsqBzpuz5H//U1FU=
@@ -753,14 +750,13 @@ github.com/opencontainers/selinux v1.10.0/go.mod h1:2i0OySw99QjzBBQByd1Gr9gSjvuh
 github.com/opentracing/opentracing-go v1.1.0/go.mod h1:UkNAQd3GIcIGf0SeVgPpRdFStlNbqXla1AfSYxPUl2o=
 github.com/pelletier/go-toml v1.8.1/go.mod h1:T2/BmBdy8dvIRq1a/8aqjN41wvWlN4lrapLU/GW4pbc=
 github.com/peterbourgon/diskv v2.0.1+incompatible/go.mod h1:uqqh8zWWbv1HBMNONnaR/tNboyR3/BZd58JJSHlUSCU=
-github.com/pjbgf/sha1cd v0.5.0 h1:a+UkboSi1znleCDUNT3M5YxjOnN1fz2FhN48FlwCxs0=
-github.com/pjbgf/sha1cd v0.5.0/go.mod h1:lhpGlyHLpQZoxMv8HcgXvZEhcGs0PG/vsZnEJ7H0iCM=
+github.com/pjbgf/sha1cd v0.7.0 h1:ZRNPKHj+gfkLBf0KJv/p1Hmz+7bqCT5o311YX0nq+DA=
+github.com/pjbgf/sha1cd v0.7.0/go.mod h1:pKR5Li+qTCo+ebqITZfwPlJGoCFCvSO00qxjbNtTUFQ=
 github.com/pkg/errors v0.8.0/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
 github.com/pkg/errors v0.8.1-0.20171018195549-f15c970de5b7/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
 github.com/pkg/errors v0.8.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
 github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4=
 github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
-github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
 github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
 github.com/pquerna/cachecontrol v0.0.0-20171018203845-0dec1b30a021/go.mod h1:prYjPmNq4d1NPVmpShWobRqXY3q7Vp+80DqgxxUrUIA=
 github.com/prometheus/client_golang v0.0.0-20180209125602-c332b6f63c06/go.mod h1:7SWBe2y4D6OKWSNQJUaRYU/AaXPKyh/dDVn+NZz0KFw=
@@ -808,8 +804,8 @@ github.com/russross/blackfriday/v2 v2.1.0 h1:JIOH55/0cWyOuilr9/qlrm0BSXldqnqwMsf
 github.com/russross/blackfriday/v2 v2.1.0/go.mod h1:+Rmxgy9KzJVeS9/2gXHxylqXiyQDYRxCVz55jmeOWTM=
 github.com/safchain/ethtool v0.0.0-20190326074333-42ed695e3de8/go.mod h1:Z0q5wiBQGYcxhMZ6gUqHn6pYNLypFAvaL3UvgZLR0U4=
 github.com/satori/go.uuid v1.2.0/go.mod h1:dA0hQrYB0VpLJoorglMZABFdXlWrHn1NEOzdhQKdks0=
-github.com/schollz/progressbar/v3 v3.19.0 h1:Ea18xuIRQXLAUidVDox3AbwfUhD0/1IvohyTutOIFoc=
-github.com/schollz/progressbar/v3 v3.19.0/go.mod h1:IsO3lpbaGuzh8zIMzgY3+J8l4C8GjO0Y9S69eFvNsec=
+github.com/schollz/progressbar/v3 v3.19.1 h1:iv8BgwOvdML/S3p84uBpy/IMigv4U9594vPZYa2EdrU=
+github.com/schollz/progressbar/v3 v3.19.1/go.mod h1:LFL7jqimKxfhero4K1eCkUr/6R39AgQeiPCJtlTWIW8=
 github.com/sclevine/spec v1.2.0/go.mod h1:W4J29eT/Kzv7/b9IWLB055Z+qvVC9vt0Arko24q7p+U=
 github.com/seccomp/libseccomp-golang v0.9.1/go.mod h1:GbW5+tmTXfcxTToHLXlScSlAvWlF4P2Ca7zGrPiEpWo=
 github.com/seccomp/libseccomp-golang v0.9.2-0.20210429002308-3879420cc921/go.mod h1:JA8cRccbGaA1s33RQf7Y1+q9gHmZX1yB/z9WDN1C6fg=
@@ -857,8 +853,8 @@ github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81P
 github.com/stretchr/testify v1.5.1/go.mod h1:5W2xD1RspED5o8YsWQXVCued0rvSQ+mT+I5cxcmMvtA=
 github.com/stretchr/testify v1.6.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg=
 github.com/stretchr/testify v1.7.0/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg=
-github.com/stretchr/testify v1.11.1 h1:7s2iGBzp5EwR7/aIZr8ao5+dra3wiQyKjjFuvgVKu7U=
-github.com/stretchr/testify v1.11.1/go.mod h1:wZwfW3scLgRK+23gO65QZefKpKQRnfz6sD981Nm4B6U=
+github.com/stretchr/testify v1.12.1 h1:EuwCh5fleGS7H32xRwO3wRGT7DxrDhLAT6FF8MpWDWE=
+github.com/stretchr/testify v1.12.1/go.mod h1:MDEgiDPPsNp5cuIrHPPCyornHKgEVbtFUmoNlxoYthg=
 github.com/syndtr/gocapability v0.0.0-20170704070218-db04d3cc01c8/go.mod h1:hkRG7XYTFWNJGYcbNJQlaLq0fg1yr4J4t/NcTQtrfww=
 github.com/syndtr/gocapability v0.0.0-20180916011248-d98352740cb2/go.mod h1:hkRG7XYTFWNJGYcbNJQlaLq0fg1yr4J4t/NcTQtrfww=
 github.com/syndtr/gocapability v0.0.0-20200815063812-42c35b437635 h1:kdXcSzyDtseVEc4yCz2qF8ZrQvIDBJLl4S1c3GCXmoI=
@@ -946,8 +942,9 @@ go.uber.org/multierr v1.1.0/go.mod h1:wR5kodmAFQ0UK8QlbwjlSNy0Z68gJhDJUG5sjR94q/
 go.uber.org/zap v1.10.0/go.mod h1:vwi/ZaCAaUcBkycHslxD9B2zi4UTXhF60s6SWpuDF0Q=
 go.yaml.in/yaml/v2 v2.4.4 h1:tuyd0P+2Ont/d6e2rl3be67goVK4R6deVxCUX5vyPaQ=
 go.yaml.in/yaml/v2 v2.4.4/go.mod h1:gMZqIpDtDqOfM0uNfy0SkpRhvUryYH0Z6wdMYcacYXQ=
-go.yaml.in/yaml/v3 v3.0.4 h1:tfq32ie2Jv2UxXFdLJdh3jXuOzWiL1fo0bu/FbuKpbc=
 go.yaml.in/yaml/v3 v3.0.4/go.mod h1:DhzuOOF2ATzADvBadXxruRBLzYTpT36CKvDb3+aBEFg=
+go.yaml.in/yaml/v3 v3.0.5 h1:N6y/pJk8buWs9NY5ERU2HSMfm+IuD/OtfdAnq6kESPw=
+go.yaml.in/yaml/v3 v3.0.5/go.mod h1:HVTZu1O7/Vkt2N+BFy8Zza+lnLsABggaTM2ZpNIGuKg=
 golang.org/x/crypto v0.0.0-20171113213409-9f005a07e0d3/go.mod h1:6SG95UA2DQfeDnfUPMdvaQW0Q7yPrPDi9nlGo2tz2b4=
 golang.org/x/crypto v0.0.0-20180904163835-0709b304e793/go.mod h1:6SG95UA2DQfeDnfUPMdvaQW0Q7yPrPDi9nlGo2tz2b4=
 golang.org/x/crypto v0.0.0-20181009213950-7c1a557ab941/go.mod h1:6SG95UA2DQfeDnfUPMdvaQW0Q7yPrPDi9nlGo2tz2b4=
@@ -966,8 +963,8 @@ golang.org/x/crypto v0.0.0-20201117144127-c1f2f97bffc9/go.mod h1:jdWPYTVW3xRLrWP
 golang.org/x/crypto v0.0.0-20210322153248-0c34fe9e7dc2/go.mod h1:T9bdIzuCu7OtxOm1hfPfRQxPLYneinmdGuTeoZ9dtd4=
 golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc=
 golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4=
-golang.org/x/crypto v0.49.0 h1:+Ng2ULVvLHnJ/ZFEq4KdcDd/cfjrrjjNSXNzxg0Y4U4=
-golang.org/x/crypto v0.49.0/go.mod h1:ErX4dUh2UM+CFYiXZRTcMpEcN8b/1gxEuv3nODoYtCA=
+golang.org/x/crypto v0.56.0 h1:GUh5Ii4J5jtcseSMiRqr1jXCNHoxjeV9Fmekc2oLy6Y=
+golang.org/x/crypto v0.56.0/go.mod h1:OMW5y6CY9l38uPLmxU6l6pwcXp1obtLo3e6gT7gQR2I=
 golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA=
 golang.org/x/exp v0.0.0-20190306152737-a1d7652674e8/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA=
 golang.org/x/exp v0.0.0-20190510132918-efd6b22b2522/go.mod h1:ZjyILWgesfNpC6sMxTJOJm9Kp84zZh5NQWvqDGG3Qr8=
@@ -978,8 +975,8 @@ golang.org/x/exp v0.0.0-20191227195350-da58074b4299/go.mod h1:2RIsYlXP63K8oxa1u0
 golang.org/x/exp v0.0.0-20200119233911-0405dc783f0a/go.mod h1:2RIsYlXP63K8oxa1u096TMicItID8zy7Y6sNkU49FU4=
 golang.org/x/exp v0.0.0-20200207192155-f17229e696bd/go.mod h1:J/WKrq2StrnmMY6+EHIKF9dgMWnmCNThgcyBT1FY9mM=
 golang.org/x/exp v0.0.0-20200224162631-6cc2880d07d6/go.mod h1:3jZMyOhIsHpP37uCMkUooju7aAi5cS1Q23tOzKc+0MU=
-golang.org/x/exp v0.0.0-20260312153236-7ab1446f8b90 h1:jiDhWWeC7jfWqR9c/uplMOqJ0sbNlNWv0UkzE0vX1MA=
-golang.org/x/exp v0.0.0-20260312153236-7ab1446f8b90/go.mod h1:xE1HEv6b+1SCZ5/uscMRjUBKtIxworgEcEi+/n9NQDQ=
+golang.org/x/exp v0.0.0-20260410095643-746e56fc9e2f h1:W3F4c+6OLc6H2lb//N1q4WpJkhzJCK5J6kUi1NTVXfM=
+golang.org/x/exp v0.0.0-20260410095643-746e56fc9e2f/go.mod h1:J1xhfL/vlindoeF/aINzNzt2Bket5bjo9sdOYzOsU80=
 golang.org/x/image v0.0.0-20190227222117-0694c2d4d067/go.mod h1:kZ7UVZpmo3dzQBMxlp+ypCbDeSB+sBbTgSJuh5dn5js=
 golang.org/x/image v0.0.0-20190802002840-cff245a6509b/go.mod h1:FeLwcggjj3mMvU+oOTbSwawSJRM1uh48EjtB4UJZlP0=
 golang.org/x/lint v0.0.0-20181026193005-c67002cb31c3/go.mod h1:UVdnD1Gm6xHRNCYTkRU2/jEulfH38KcIWyp/GAMgvoE=
@@ -1043,8 +1040,8 @@ golang.org/x/net v0.0.0-20210405180319-a5a99cb37ef4/go.mod h1:p54w0d4576C0XHj96b
 golang.org/x/net v0.0.0-20210825183410-e898025ed96a/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
 golang.org/x/net v0.0.0-20211112202133-69e39bad7dc2/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
 golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c=
-golang.org/x/net v0.52.0 h1:He/TN1l0e4mmR3QqHMT2Xab3Aj3L9qjbhRm78/6jrW0=
-golang.org/x/net v0.52.0/go.mod h1:R1MAz7uMZxVMualyPXb+VaqGSa3LIaUqk0eEt3w36Sw=
+golang.org/x/net v0.57.0 h1:K5+3DljvIuDG9/Jv9rvyMywYNFCQ9RSUY6OOTTkT+tE=
+golang.org/x/net v0.57.0/go.mod h1:KpXc8iv+r3XplLAG/f7Jsf9RPszJzdR0f58q9vGOuEU=
 golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U=
 golang.org/x/oauth2 v0.0.0-20190226205417-e64efc72b421/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw=
 golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw=
@@ -1139,14 +1136,13 @@ golang.org/x/sys v0.0.0-20211216021012-1d35b9e2eb4e/go.mod h1:oPkhp1MJrh7nUepCBc
 golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.6.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.42.0 h1:omrd2nAlyT5ESRdCLYdm3+fMfNFE/+Rf4bDIQImRJeo=
-golang.org/x/sys v0.42.0/go.mod h1:4GL1E5IUh+htKOUEOaiffhrAeqysfVGipDYzABqnCmw=
+golang.org/x/sys v0.48.0 h1:bbX/i/6MgT9BVLM9RT1thmxL04yeTAhbEz4SyadbXoo=
+golang.org/x/sys v0.48.0/go.mod h1:hNLxWAXmnKAxqDtdwIYC4bM9oQPEecfsnNMuSxOs3og=
 golang.org/x/term v0.0.0-20201117132131-f5c789dd3221/go.mod h1:Nr5EML6q2oocZ2LXRh80K7BxOlk5/8JxuGnuhpl+muw=
 golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
 golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8=
-golang.org/x/term v0.41.0 h1:QCgPso/Q3RTJx2Th4bDLqML4W6iJiaXFq2/ftQF13YU=
-golang.org/x/term v0.41.0/go.mod h1:3pfBgksrReYfZ5lvYM0kSO0LIkAl4Yl2bXOkKP7Ec2A=
+golang.org/x/term v0.46.0 h1:3+OXuTbaKDgwk8jTi3aSLHRlmWqHEUDUtxnbFigO4YE=
+golang.org/x/term v0.46.0/go.mod h1:+K02xbkittuwc0Am4abfA3Fc+XRGXkvBXNO88NCXPoc=
 golang.org/x/text v0.0.0-20170915032832-14c0d48ead0c/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
 golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
 golang.org/x/text v0.3.1-0.20180807135948-17ff2d5776d2/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
@@ -1156,8 +1152,8 @@ golang.org/x/text v0.3.4/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
 golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
 golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ=
 golang.org/x/text v0.4.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8=
-golang.org/x/text v0.35.0 h1:JOVx6vVDFokkpaq1AEptVzLTpDe9KGpj5tR4/X+ybL8=
-golang.org/x/text v0.35.0/go.mod h1:khi/HExzZJ2pGnjenulevKNX1W67CUy0AsXcNubPGCA=
+golang.org/x/text v0.41.0 h1:vz/seA0lnX87Othu2f/0L24RcgrXD9/YFTSuGjj3rH8=
+golang.org/x/text v0.41.0/go.mod h1:jvf1O8ajNzZqhSrQBPbutR/EB83Cc0CFrezNQIwbb5M=
 golang.org/x/time v0.0.0-20180412165947-fbb02b2291d2/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ=
 golang.org/x/time v0.0.0-20181108054448-85acf8d2951c/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ=
 golang.org/x/time v0.0.0-20190308202827-9d24e82272b4/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ=
@@ -0,0 +1,54 @@
+{
+  buildGo126Module,
+  fetchgit,
+  lib,
+  installShellFiles,
+}:
+
+buildGo126Module rec {
+  pname = "abra";
+  version = "0.13.0-beta";
+  rev = "06a57ded025a43c80f94d4e65299add8a31830dc";
+
+  src = fetchgit {
+    url = "https://git.coopcloud.tech/toolshed/abra.git";
+    tag = version;
+    hash = "sha256-rgoK0TY0WLSQ39lPvVM80zW/qJF40VFBSxYDOaKXZQo=";
+  };
+
+  vendorHash = null;
+
+  nativeBuildInputs = [
+    installShellFiles
+  ];
+
+  env.CGO_ENABLED = 0;
+  buildPhase = ''
+    runHook preBuild
+    go build -ldflags="-s -w -X 'main.Commit=${rev}' -X 'main.Version=${version}'" ./cmd/abra
+    runHook postBuild
+  '';
+
+  installPhase = ''
+    runHook preInstall
+    install -D abra $out/bin/abra
+    runHook postInstall
+  '';
+
+  postInstall = ''
+    export ABRA_DIR="$out"
+    $out/bin/abra autocomplete bash >abra.bash
+    $out/bin/abra autocomplete fish >abra.fish
+    $out/bin/abra autocomplete zsh >abra.zsh
+    installShellCompletion abra.{bash,fish,zsh}
+  '';
+
+  meta = with lib; {
+    description = "The Co-op Cloud utility belt";
+    homepage = "https://docs.coopcloud.tech/abra";
+    changelog = "https://git.coopcloud.tech/toolshed/abra/releases/tag/${version}";
+    mainProgram = "abra";
+    license = licenses.gpl3Plus;
+    maintainers = "devydave";
+  };
+}
@@ -52,7 +52,6 @@ func Clone(dir, url string) error {
 				URL:           url,
 				Tags:          git.AllTags,
 				ReferenceName: plumbing.ReferenceName("refs/heads/main"),
-				SingleBranch:  true,
 			})

 			if err != nil && gitCloneIgnoreErr(err) {
@@ -71,7 +70,6 @@ func Clone(dir, url string) error {
 					URL:           url,
 					Tags:          git.AllTags,
 					ReferenceName: plumbing.ReferenceName("refs/heads/master"),
-					SingleBranch:  true,
 				})

 				if err != nil && gitCloneIgnoreErr(err) {
@@ -7,7 +7,7 @@
 msgid   ""
 msgstr  "Project-Id-Version: \n"
        "Report-Msgid-Bugs-To: EMAIL\n"
-        "POT-Creation-Date: 2026-04-11 11:34+0200\n"
+        "POT-Creation-Date: 2026-08-31 19:21+0000\n"
        "PO-Revision-Date: YEAR-MO-DA HO:MI+ZONE\n"
        "Last-Translator: FULL NAME <EMAIL@ADDRESS>\n"
        "Language-Team: LANGUAGE <LL@li.org>\n"
@@ -189,7 +189,7 @@ msgstr  ""
 msgid   "%d volumes removed successfully"
 msgstr  ""

-#: ./pkg/recipe/git.go:197
+#: ./pkg/recipe/git.go:198
 #, c-format
 msgid   "%s (%s) has locally unstaged changes?"
 msgstr  ""
@@ -214,7 +214,7 @@ msgstr  ""
 msgid   "%s already exists?"
 msgstr  ""

-#: ./cli/app/new.go:202
+#: ./cli/app/new.go:206
 #, c-format
 msgid   "%s created (version: %s)"
 msgstr  ""
@@ -299,7 +299,7 @@ msgstr  ""
 msgid   "%s has no published versions?"
 msgstr  ""

-#: ./cli/app/new.go:311
+#: ./cli/app/new.go:315
 #, c-format
 msgid   "%s has no secrets to generate, skipping..."
 msgstr  ""
@@ -339,17 +339,17 @@ msgstr  ""
 msgid   "%s is missing the TYPE env var?"
 msgstr  ""

-#: ./cli/app/rollback.go:309 ./cli/app/rollback.go:313
+#: ./cli/app/rollback.go:310 ./cli/app/rollback.go:314
 #, c-format
 msgid   "%s is not a downgrade for %s?"
 msgstr  ""

-#: ./cli/app/upgrade.go:429 ./cli/app/upgrade.go:433
+#: ./cli/app/upgrade.go:430 ./cli/app/upgrade.go:434
 #, c-format
 msgid   "%s is not an upgrade for %s?"
 msgstr  ""

-#: ./cli/app/env.go:146 ./cli/app/logs.go:65 ./cli/app/ps.go:62 ./cli/app/restart.go:100 ./cli/app/services.go:55 ./cli/app/undeploy.go:66 ./cli/app/upgrade.go:450
+#: ./cli/app/env.go:146 ./cli/app/logs.go:65 ./cli/app/ps.go:62 ./cli/app/restart.go:100 ./cli/app/services.go:55 ./cli/app/undeploy.go:66 ./cli/app/upgrade.go:451
 #, c-format
 msgid   "%s is not deployed?"
 msgstr  ""
@@ -369,7 +369,7 @@ msgstr  ""
 msgid   "%s missing context, run \"abra server add %s\"?"
 msgstr  ""

-#: ./cli/app/deploy.go:194 ./cli/app/upgrade.go:210
+#: ./cli/app/deploy.go:195 ./cli/app/upgrade.go:211
 #, c-format
 msgid   "%s missing from %s.env"
 msgstr  ""
@@ -404,22 +404,22 @@ msgstr  ""
 msgid   "%s removed from pass store"
 msgstr  ""

-#: ./cli/app/new.go:220
+#: ./cli/app/new.go:224
 #, c-format
 msgid   "%s requires secret generation before deploy, run \"abra app secret generate %s --all\""
 msgstr  ""

-#: ./cli/app/new.go:224
+#: ./cli/app/new.go:228
 #, c-format
 msgid   "%s requires secret insertion before deploy (#generate=false)"
 msgstr  ""

-#: ./cli/app/new.go:151
+#: ./cli/app/new.go:155
 #, c-format
 msgid   "%s sanitised as %s for new app"
 msgstr  ""

-#: ./pkg/recipe/git.go:445
+#: ./pkg/recipe/git.go:451
 #, c-format
 msgid   "%s service is missing image tag?"
 msgstr  ""
@@ -549,12 +549,12 @@ msgstr  ""
 msgid   "%s: waiting %d seconds before next retry"
 msgstr  ""

-#: ./cli/app/upgrade.go:424
+#: ./cli/app/upgrade.go:425
 #, c-format
 msgid   "'%s' is not a known version"
 msgstr  ""

-#: ./cli/app/rollback.go:304 ./cli/app/upgrade.go:419
+#: ./cli/app/rollback.go:305 ./cli/app/upgrade.go:420
 #, c-format
 msgid   "'%s' is not a known version for %s"
 msgstr  ""
@@ -626,7 +626,7 @@ msgstr  ""
 msgid   "Both local recipe and live deployment labels are shown."
 msgstr  ""

-#: ./cli/app/backup.go:319 ./cli/app/backup.go:335 ./cli/app/check.go:95 ./cli/app/cmd.go:285 ./cli/app/cp.go:385 ./cli/app/deploy.go:414 ./cli/app/labels.go:143 ./cli/app/list.go:335 ./cli/app/new.go:407 ./cli/app/ps.go:213 ./cli/app/restart.go:163 ./cli/app/restore.go:138 ./cli/app/secret.go:569 ./cli/app/secret.go:609 ./cli/app/secret.go:633 ./cli/app/secret.go:641 ./cli/catalogue/catalogue.go:318 ./cli/recipe/lint.go:137
+#: ./cli/app/backup.go:319 ./cli/app/backup.go:335 ./cli/app/check.go:95 ./cli/app/cmd.go:285 ./cli/app/cp.go:385 ./cli/app/deploy.go:415 ./cli/app/labels.go:143 ./cli/app/list.go:335 ./cli/app/new.go:411 ./cli/app/ps.go:213 ./cli/app/restart.go:163 ./cli/app/restore.go:138 ./cli/app/secret.go:569 ./cli/app/secret.go:609 ./cli/app/secret.go:633 ./cli/app/secret.go:641 ./cli/catalogue/catalogue.go:318 ./cli/recipe/lint.go:137
 msgid   "C"
 msgstr  ""

@@ -767,7 +767,7 @@ msgid   "Creates a new app from a default recipe.\n"
        "on your $PATH."
 msgstr  ""

-#: ./cli/app/deploy.go:430 ./cli/app/new.go:383 ./cli/app/rollback.go:361 ./cli/app/upgrade.go:470
+#: ./cli/app/deploy.go:431 ./cli/app/new.go:387 ./cli/app/rollback.go:362 ./cli/app/upgrade.go:471
 msgid   "D"
 msgstr  ""

@@ -878,7 +878,7 @@ msgid   "Generate a report of all managed apps.\n"
        "Use \"--status/-S\" flag to query all servers for the live deployment status."
 msgstr  ""

-#: ./cli/app/new.go:317
+#: ./cli/app/new.go:321
 msgid   "Generate app secrets?"
 msgstr  ""

@@ -902,7 +902,7 @@ msgstr  ""
 msgid   "Generate the recipe catalogue"
 msgstr  ""

-#: ./pkg/recipe/git.go:459
+#: ./pkg/recipe/git.go:465
 #, c-format
 msgid   "GetRecipeVersions encountered error for %s: %s (collected %d versions)"
 msgstr  ""
@@ -1257,7 +1257,7 @@ msgstr  ""
 msgid   "Run app commands"
 msgstr  ""

-#: ./cli/app/backup.go:303 ./cli/app/list.go:296 ./cli/app/logs.go:109 ./cli/app/new.go:399
+#: ./cli/app/backup.go:303 ./cli/app/list.go:296 ./cli/app/logs.go:109 ./cli/app/new.go:403
 msgid   "S"
 msgstr  ""

@@ -1265,7 +1265,7 @@ msgstr  ""
 msgid   "SECRETS"
 msgstr  ""

-#: ./cli/app/new.go:234
+#: ./cli/app/new.go:238
 msgid   "SECRETS OVERVIEW"
 msgstr  ""

@@ -1298,7 +1298,7 @@ msgstr  ""
 msgid   "STATUS"
 msgstr  ""

-#: ./cli/app/new.go:342
+#: ./cli/app/new.go:346
 msgid   "Select app server:"
 msgstr  ""

@@ -1330,7 +1330,7 @@ msgstr  ""
 msgid   "Specify a server name"
 msgstr  ""

-#: ./cli/app/new.go:293
+#: ./cli/app/new.go:297
 msgid   "Specify app domain"
 msgstr  ""

@@ -1462,7 +1462,7 @@ msgid   "To load completions:\n"
        "  # and source this file from your PowerShell profile."
 msgstr  ""

-#: ./cli/app/deploy.go:454 ./cli/app/rollback.go:377 ./cli/app/upgrade.go:494
+#: ./cli/app/deploy.go:455 ./cli/app/rollback.go:378 ./cli/app/upgrade.go:495
 msgid   "U"
 msgstr  ""

@@ -1815,7 +1815,7 @@ msgstr  ""
 msgid   "are you sure?"
 msgstr  ""

-#: ./pkg/recipe/git.go:162
+#: ./pkg/recipe/git.go:163
 #, c-format
 msgid   "attempting to checkout '%s' as chaos commit"
 msgstr  ""
@@ -1835,7 +1835,7 @@ msgstr  ""
 msgid   "attempting to run %s"
 msgstr  ""

-#: ./cli/app/deploy.go:283 ./cli/app/upgrade.go:296
+#: ./cli/app/deploy.go:284 ./cli/app/upgrade.go:297
 #, c-format
 msgid   "attempting to run post deploy commands, saw: %s"
 msgstr  ""
@@ -1865,7 +1865,7 @@ msgstr  ""
 msgid   "autocomplete failed: %s"
 msgstr  ""

-#: ./cli/app/new.go:401
+#: ./cli/app/new.go:405
 msgid   "automatically generate secrets"
 msgstr  ""

@@ -1915,7 +1915,7 @@ msgstr  ""
 #. no spaces in between
 #. translators: `abra app cp` aliases. use a comma separated list of aliases with
 #. no spaces in between
-#: ./cli/app/backup.go:148 ./cli/app/cp.go:30 ./cli/app/deploy.go:438 ./cli/app/rollback.go:369 ./cli/app/upgrade.go:478
+#: ./cli/app/backup.go:148 ./cli/app/cp.go:30 ./cli/app/deploy.go:439 ./cli/app/rollback.go:370 ./cli/app/upgrade.go:479
 msgid   "c"
 msgstr  ""

@@ -1951,7 +1951,7 @@ msgstr  ""
 msgid   "cancelled"
 msgstr  ""

-#: ./pkg/catalogue/catalogue.go:59 ./pkg/recipe/git.go:251
+#: ./pkg/catalogue/catalogue.go:59 ./pkg/recipe/git.go:252
 #, c-format
 msgid   "cannot ensure %s is up-to-date, no git remotes configured"
 msgstr  ""
@@ -1966,12 +1966,12 @@ msgstr  ""
 msgid   "cannot get label %s for %s"
 msgstr  ""

-#: ./pkg/recipe/git.go:58
+#: ./pkg/recipe/git.go:59
 #, c-format
 msgid   "cannot redeploy previous chaos version (%s), did you mean to use \"--chaos\"?"
 msgstr  ""

-#: ./cli/app/deploy.go:388
+#: ./cli/app/deploy.go:389
 #, c-format
 msgid   "cannot redeploy previous chaos version (%s), did you mean to use \"--chaos\"?\n"
        "     to return to a regular release, specify a release tag, commit SHA or use \"--latest\""
@@ -1990,7 +1990,7 @@ msgstr  ""
 msgid   "cannot use '[secret] [version]' and '--all' together"
 msgstr  ""

-#: ./cli/app/deploy.go:330
+#: ./cli/app/deploy.go:331
 msgid   "cannot use --chaos and --latest together"
 msgstr  ""

@@ -2014,11 +2014,11 @@ msgstr  ""
 msgid   "cannot use [service] and --all-services/-a together"
 msgstr  ""

-#: ./cli/app/deploy.go:322 ./cli/app/new.go:80
+#: ./cli/app/deploy.go:323 ./cli/app/new.go:80
 msgid   "cannot use [version] and --chaos together"
 msgstr  ""

-#: ./cli/app/deploy.go:326
+#: ./cli/app/deploy.go:327
 msgid   "cannot use [version] and --latest together"
 msgstr  ""

@@ -2054,7 +2054,7 @@ msgstr  ""
 msgid   "cfg"
 msgstr  ""

-#: ./cli/app/backup.go:318 ./cli/app/backup.go:334 ./cli/app/check.go:94 ./cli/app/cmd.go:284 ./cli/app/cp.go:384 ./cli/app/deploy.go:413 ./cli/app/labels.go:142 ./cli/app/list.go:334 ./cli/app/new.go:406 ./cli/app/ps.go:212 ./cli/app/restart.go:162 ./cli/app/restore.go:137 ./cli/app/secret.go:568 ./cli/app/secret.go:608 ./cli/app/secret.go:632 ./cli/app/secret.go:640 ./cli/catalogue/catalogue.go:317 ./cli/recipe/lint.go:136
+#: ./cli/app/backup.go:318 ./cli/app/backup.go:334 ./cli/app/check.go:94 ./cli/app/cmd.go:284 ./cli/app/cp.go:384 ./cli/app/deploy.go:414 ./cli/app/labels.go:142 ./cli/app/list.go:334 ./cli/app/new.go:410 ./cli/app/ps.go:212 ./cli/app/restart.go:162 ./cli/app/restore.go:137 ./cli/app/secret.go:568 ./cli/app/secret.go:608 ./cli/app/secret.go:632 ./cli/app/secret.go:640 ./cli/catalogue/catalogue.go:317 ./cli/recipe/lint.go:136
 msgid   "chaos"
 msgstr  ""

@@ -2068,7 +2068,7 @@ msgstr  ""
 msgid   "check <domain> [flags]"
 msgstr  ""

-#: ./cli/app/deploy.go:95 ./cli/app/undeploy.go:58 ./cli/app/upgrade.go:442
+#: ./cli/app/deploy.go:95 ./cli/app/undeploy.go:58 ./cli/app/upgrade.go:443
 #, c-format
 msgid   "checking whether %s is already deployed"
 msgstr  ""
@@ -2118,7 +2118,7 @@ msgstr  ""
 msgid   "cmd"
 msgstr  ""

-#: ./pkg/recipe/git.go:470
+#: ./pkg/recipe/git.go:476
 #, c-format
 msgid   "collected %s for %s"
 msgstr  ""
@@ -2371,7 +2371,7 @@ msgstr  ""
 msgid   "critical errors present in %s config"
 msgstr  ""

-#: ./cli/app/rollback.go:299
+#: ./cli/app/rollback.go:300
 #, c-format
 msgid   "current deployment '%s' is not a known version for %s"
 msgstr  ""
@@ -2422,7 +2422,7 @@ msgstr  ""
 msgid   "deploy labels stanza present"
 msgstr  ""

-#: ./cli/app/deploy.go:448
+#: ./cli/app/deploy.go:449
 msgid   "deploy latest recipe version"
 msgstr  ""

@@ -2456,7 +2456,7 @@ msgstr  ""
 msgid   "destination directory does not exist"
 msgstr  ""

-#: ./pkg/recipe/git.go:373
+#: ./pkg/recipe/git.go:379
 #, c-format
 msgid   "detected %s as tags for recipe %s"
 msgstr  ""
@@ -2524,11 +2524,11 @@ msgstr  ""
 msgid   "dirty: %v, "
 msgstr  ""

-#: ./cli/app/deploy.go:440 ./cli/app/rollback.go:371 ./cli/app/upgrade.go:480
+#: ./cli/app/deploy.go:441 ./cli/app/rollback.go:372 ./cli/app/upgrade.go:481
 msgid   "disable converge logic checks"
 msgstr  ""

-#: ./cli/app/deploy.go:432 ./cli/app/rollback.go:363 ./cli/app/upgrade.go:472
+#: ./cli/app/deploy.go:433 ./cli/app/rollback.go:364 ./cli/app/upgrade.go:473
 msgid   "disable public DNS checks"
 msgstr  ""

@@ -2544,11 +2544,11 @@ msgstr  ""
 msgid   "docker: is the daemon running / your user has docker permissions?"
 msgstr  ""

-#: ./cli/app/new.go:382
+#: ./cli/app/new.go:386
 msgid   "domain"
 msgstr  ""

-#: ./cli/app/new.go:385
+#: ./cli/app/new.go:389
 msgid   "domain name for app"
 msgstr  ""

@@ -2653,7 +2653,7 @@ msgstr  ""
 msgid   "ensure recipe: %s"
 msgstr  ""

-#: ./pkg/recipe/git.go:56
+#: ./pkg/recipe/git.go:57
 #, c-format
 msgid   "ensuring env version %s"
 msgstr  ""
@@ -2737,7 +2737,7 @@ msgstr  ""

 #. translators: `abra recipe fetch` aliases. use a comma separated list of aliases
 #. with no spaces in between
-#: ./cli/app/deploy.go:422 ./cli/app/env.go:325 ./cli/app/remove.go:163 ./cli/app/rollback.go:353 ./cli/app/secret.go:593 ./cli/app/upgrade.go:462 ./cli/app/volume.go:217 ./cli/recipe/fetch.go:20 ./cli/recipe/fetch.go:138
+#: ./cli/app/deploy.go:423 ./cli/app/env.go:325 ./cli/app/remove.go:163 ./cli/app/rollback.go:354 ./cli/app/secret.go:593 ./cli/app/upgrade.go:463 ./cli/app/volume.go:217 ./cli/recipe/fetch.go:20 ./cli/recipe/fetch.go:138
 msgid   "f"
 msgstr  ""

@@ -2751,12 +2751,12 @@ msgstr  ""
 msgid   "failed to check git status of %s: %s"
 msgstr  ""

-#: ./pkg/git/branch.go:95 ./pkg/recipe/git.go:231
+#: ./pkg/git/branch.go:95 ./pkg/recipe/git.go:232
 #, c-format
 msgid   "failed to check out %s in %s"
 msgstr  ""

-#: ./pkg/recipe/git.go:412
+#: ./pkg/recipe/git.go:418
 #, c-format
 msgid   "failed to check out %s in %s: %s"
 msgstr  ""
@@ -2806,7 +2806,7 @@ msgstr  ""
 msgid   "failed to generate random bytes: %w"
 msgstr  ""

-#: ./pkg/recipe/git.go:421
+#: ./pkg/recipe/git.go:427
 #, c-format
 msgid   "failed to get compose config for %s: %s"
 msgstr  ""
@@ -2844,7 +2844,7 @@ msgstr  ""
 msgid   "failed to parse image %s, saw: %s"
 msgstr  ""

-#: ./pkg/recipe/git.go:431
+#: ./pkg/recipe/git.go:437
 #, c-format
 msgid   "failed to parse image for %s in %s: %s"
 msgstr  ""
@@ -2898,7 +2898,7 @@ msgstr  ""
 msgid   "failed to resize tty, using default size"
 msgstr  ""

-#: ./cli/app/new.go:134
+#: ./cli/app/new.go:138
 #, c-format
 msgid   "failed to retrieve latest commit for %s: %s"
 msgstr  ""
@@ -2952,7 +2952,7 @@ msgstr  ""
 msgid   "fetch all recipes"
 msgstr  ""

-#: ./pkg/catalogue/catalogue.go:84 ./pkg/recipe/git.go:284
+#: ./pkg/catalogue/catalogue.go:84 ./pkg/recipe/git.go:290
 #, c-format
 msgid   "fetched latest git changes for %s"
 msgstr  ""
@@ -2988,7 +2988,7 @@ msgstr  ""
 msgid   "final merged env values for %s are: %s"
 msgstr  ""

-#: ./cli/app/deploy.go:421 ./cli/app/env.go:324 ./cli/app/remove.go:162 ./cli/app/rollback.go:352 ./cli/app/upgrade.go:461 ./cli/app/volume.go:216 ./cli/recipe/fetch.go:137
+#: ./cli/app/deploy.go:422 ./cli/app/env.go:324 ./cli/app/remove.go:162 ./cli/app/rollback.go:353 ./cli/app/upgrade.go:462 ./cli/app/volume.go:216 ./cli/recipe/fetch.go:137
 msgid   "force"
 msgstr  ""

@@ -3070,12 +3070,12 @@ msgstr  ""
 msgid   "git changes pushed"
 msgstr  ""

-#: ./pkg/recipe/git.go:417
+#: ./pkg/recipe/git.go:423
 #, c-format
 msgid   "git checkout: %s in %s"
 msgstr  ""

-#: ./pkg/git/clone.go:64 ./pkg/git/clone.go:102
+#: ./pkg/git/clone.go:63 ./pkg/git/clone.go:100
 #, c-format
 msgid   "git clone %s: cancelled due to interrupt"
 msgstr  ""
@@ -3085,17 +3085,17 @@ msgstr  ""
 msgid   "git clone: %s"
 msgstr  ""

-#: ./pkg/git/clone.go:89
+#: ./pkg/git/clone.go:87
 #, c-format
 msgid   "git clone: %s already exists"
 msgstr  ""

-#: ./pkg/git/clone.go:59 ./pkg/git/clone.go:78 ./pkg/git/clone.go:87
+#: ./pkg/git/clone.go:58 ./pkg/git/clone.go:76 ./pkg/git/clone.go:85
 #, c-format
 msgid   "git clone: %s cloned successfully"
 msgstr  ""

-#: ./pkg/git/clone.go:68
+#: ./pkg/git/clone.go:67
 msgid   "git clone: main branch failed, attempting master branch"
 msgstr  ""

@@ -3150,7 +3150,7 @@ msgstr  ""
 msgid   "git.coopcloud.tech repo exists"
 msgstr  ""

-#: ./pkg/recipe/git.go:384
+#: ./pkg/recipe/git.go:390
 #, c-format
 msgid   "git: opening repository in %s"
 msgstr  ""
@@ -3202,7 +3202,7 @@ msgstr  ""
 msgid   "id: %s, "
 msgstr  ""

-#: ./cli/app/backup.go:321 ./cli/app/backup.go:337 ./cli/app/check.go:97 ./cli/app/cmd.go:287 ./cli/app/cp.go:387 ./cli/app/deploy.go:416 ./cli/app/labels.go:145 ./cli/app/list.go:337 ./cli/app/new.go:409 ./cli/app/ps.go:215 ./cli/app/restart.go:165 ./cli/app/restore.go:140 ./cli/app/secret.go:571 ./cli/app/secret.go:611 ./cli/app/secret.go:635 ./cli/app/secret.go:643 ./cli/catalogue/catalogue.go:320 ./cli/recipe/lint.go:139
+#: ./cli/app/backup.go:321 ./cli/app/backup.go:337 ./cli/app/check.go:97 ./cli/app/cmd.go:287 ./cli/app/cp.go:387 ./cli/app/deploy.go:417 ./cli/app/labels.go:145 ./cli/app/list.go:337 ./cli/app/new.go:413 ./cli/app/ps.go:215 ./cli/app/restart.go:165 ./cli/app/restore.go:140 ./cli/app/secret.go:571 ./cli/app/secret.go:611 ./cli/app/secret.go:635 ./cli/app/secret.go:643 ./cli/catalogue/catalogue.go:320 ./cli/recipe/lint.go:139
 msgid   "ignore uncommitted recipes changes"
 msgstr  ""

@@ -3400,7 +3400,7 @@ msgstr  ""
 #. no spaces in between
 #. translators: `abra recipe lint` aliases. use a comma separated list of
 #. aliases with no spaces in between
-#: ./cli/app/cmd.go:261 ./cli/app/deploy.go:446 ./cli/app/logs.go:20 ./cli/recipe/lint.go:17 ./cli/server/add.go:207
+#: ./cli/app/cmd.go:261 ./cli/app/deploy.go:447 ./cli/app/logs.go:20 ./cli/recipe/lint.go:17 ./cli/server/add.go:207
 msgid   "l"
 msgstr  ""

@@ -3415,7 +3415,7 @@ msgstr  ""
 msgid   "labels <domain> [flags]"
 msgstr  ""

-#: ./cli/app/deploy.go:445 ./cli/app/list.go:186
+#: ./cli/app/deploy.go:446 ./cli/app/list.go:186
 msgid   "latest"
 msgstr  ""

@@ -3752,7 +3752,7 @@ msgstr  ""
 msgid   "no containers matching the %v filter found?"
 msgstr  ""

-#: ./cli/app/new.go:302 ./cli/internal/validate.go:129
+#: ./cli/app/new.go:306 ./cli/internal/validate.go:129
 msgid   "no domain provided"
 msgstr  ""

@@ -3779,7 +3779,7 @@ msgstr  ""
 msgid   "no recipe name provided"
 msgstr  ""

-#: ./cli/app/upgrade.go:241
+#: ./cli/app/upgrade.go:242
 #, c-format
 msgid   "no release notes for upgrading from %s to %s"
 msgstr  ""
@@ -3810,7 +3810,7 @@ msgstr  ""
 msgid   "no secrets to remove?"
 msgstr  ""

-#: ./cli/app/new.go:351 ./cli/internal/validate.go:167
+#: ./cli/app/new.go:355 ./cli/internal/validate.go:167
 msgid   "no server provided"
 msgstr  ""

@@ -3868,11 +3868,11 @@ msgstr  ""
 msgid   "no volumes to remove"
 msgstr  ""

-#: ./cli/app/deploy.go:437 ./cli/app/rollback.go:368 ./cli/app/upgrade.go:477
+#: ./cli/app/deploy.go:438 ./cli/app/rollback.go:369 ./cli/app/upgrade.go:478
 msgid   "no-converge-checks"
 msgstr  ""

-#: ./cli/app/deploy.go:429 ./cli/app/rollback.go:360 ./cli/app/upgrade.go:469
+#: ./cli/app/deploy.go:430 ./cli/app/rollback.go:361 ./cli/app/upgrade.go:470
 msgid   "no-domain-checks"
 msgstr  ""

@@ -3940,7 +3940,7 @@ msgstr  ""
 msgid   "only show errors"
 msgstr  ""

-#: ./cli/app/upgrade.go:488
+#: ./cli/app/upgrade.go:489
 msgid   "only show release notes"
 msgstr  ""

@@ -3952,7 +3952,7 @@ msgstr  ""
 #. with no spaces in between
 #. translators: `abra server prune` aliases. use a comma separated list of
 #. aliases with no spaces in between
-#: ./cli/app/backup.go:295 ./cli/app/new.go:391 ./cli/app/ps.go:29 ./cli/app/secret.go:561 ./cli/app/secret.go:585 ./cli/app/secret.go:625 ./cli/app/undeploy.go:169 ./cli/catalogue/catalogue.go:294 ./cli/recipe/list.go:112 ./cli/server/prune.go:18
+#: ./cli/app/backup.go:295 ./cli/app/new.go:395 ./cli/app/ps.go:29 ./cli/app/secret.go:561 ./cli/app/secret.go:585 ./cli/app/secret.go:625 ./cli/app/undeploy.go:169 ./cli/catalogue/catalogue.go:294 ./cli/recipe/list.go:112 ./cli/server/prune.go:18
 msgid   "p"
 msgstr  ""

@@ -3971,27 +3971,27 @@ msgstr  ""
 msgid   "parsed following command arguments: %s"
 msgstr  ""

-#: ./cli/app/upgrade.go:345
+#: ./cli/app/upgrade.go:346
 #, c-format
 msgid   "parsing chosen upgrade version failed: %s"
 msgstr  ""

-#: ./cli/app/upgrade.go:389
+#: ./cli/app/upgrade.go:390
 #, c-format
 msgid   "parsing deployed version failed: %s"
 msgstr  ""

-#: ./cli/app/upgrade.go:350
+#: ./cli/app/upgrade.go:351
 #, c-format
 msgid   "parsing deployment version failed: %s"
 msgstr  ""

-#: ./cli/app/upgrade.go:356 ./cli/app/upgrade.go:395
+#: ./cli/app/upgrade.go:357 ./cli/app/upgrade.go:396
 #, c-format
 msgid   "parsing recipe version failed: %s"
 msgstr  ""

-#: ./cli/app/new.go:390 ./cli/app/secret.go:560 ./cli/app/secret.go:584 ./cli/app/secret.go:624
+#: ./cli/app/new.go:394 ./cli/app/secret.go:560 ./cli/app/secret.go:584 ./cli/app/secret.go:624
 msgid   "pass"
 msgstr  ""

@@ -4011,7 +4011,7 @@ msgstr  ""
 msgid   "pattern"
 msgstr  ""

-#: ./cli/app/deploy.go:424 ./cli/app/env.go:327 ./cli/app/remove.go:165 ./cli/app/rollback.go:355 ./cli/app/upgrade.go:464 ./cli/app/volume.go:219
+#: ./cli/app/deploy.go:425 ./cli/app/env.go:327 ./cli/app/remove.go:165 ./cli/app/rollback.go:356 ./cli/app/upgrade.go:465 ./cli/app/volume.go:219
 msgid   "perform action without further prompt"
 msgstr  ""

@@ -4021,22 +4021,22 @@ msgstr  ""
 msgid   "pl,p"
 msgstr  ""

-#: ./cli/app/rollback.go:267
+#: ./cli/app/rollback.go:268
 #, c-format
 msgid   "please select a downgrade (version: %s):"
 msgstr  ""

-#: ./cli/app/rollback.go:272
+#: ./cli/app/rollback.go:273
 #, c-format
 msgid   "please select a downgrade (version: %s, chaos: %s):"
 msgstr  ""

-#: ./cli/app/upgrade.go:312
+#: ./cli/app/upgrade.go:313
 #, c-format
 msgid   "please select an upgrade (version: %s):"
 msgstr  ""

-#: ./cli/app/upgrade.go:317
+#: ./cli/app/upgrade.go:318
 #, c-format
 msgid   "please select an upgrade (version: %s, chaos: %s):"
 msgstr  ""
@@ -4061,7 +4061,7 @@ msgstr  ""
 msgid   "proceed?"
 msgstr  ""

-#: ./pkg/recipe/git.go:404
+#: ./pkg/recipe/git.go:410
 #, c-format
 msgid   "processing %s for %s"
 msgstr  ""
@@ -4119,7 +4119,7 @@ msgstr  ""
 #. with no spaces in between
 #. translators: `abra recipe` aliases. use a comma separated list of aliases
 #. with no spaces in between
-#: ./cli/app/backup.go:327 ./cli/app/list.go:304 ./cli/app/move.go:350 ./cli/app/run.go:23 ./cli/app/upgrade.go:486 ./cli/catalogue/catalogue.go:302 ./cli/recipe/recipe.go:12 ./cli/recipe/release.go:624
+#: ./cli/app/backup.go:327 ./cli/app/list.go:304 ./cli/app/move.go:350 ./cli/app/run.go:23 ./cli/app/upgrade.go:487 ./cli/catalogue/catalogue.go:302 ./cli/recipe/recipe.go:12 ./cli/recipe/release.go:624
 msgid   "r"
 msgstr  ""

@@ -4129,7 +4129,7 @@ msgstr  ""
 msgid   "re"
 msgstr  ""

-#: ./pkg/recipe/git.go:157
+#: ./pkg/recipe/git.go:158
 #, c-format
 msgid   "read %s as tags for recipe %s"
 msgstr  ""
@@ -4239,7 +4239,7 @@ msgstr  ""
 msgid   "release failed. any changes made have been reverted"
 msgstr  ""

-#: ./cli/app/upgrade.go:485
+#: ./cli/app/upgrade.go:486
 msgid   "releasenotes"
 msgstr  ""

@@ -4543,7 +4543,7 @@ msgstr  ""
 msgid   "run command locally"
 msgstr  ""

-#: ./cli/app/deploy.go:281 ./cli/app/upgrade.go:293
+#: ./cli/app/deploy.go:282 ./cli/app/upgrade.go:294
 #, c-format
 msgid   "run the following post-deploy commands: %s"
 msgstr  ""
@@ -4584,7 +4584,7 @@ msgstr  ""
 #. no spaces in between
 #. translators: `abra server` aliases. use a comma separated list of aliases
 #. with no spaces in between
-#: ./cli/app/backup.go:198 ./cli/app/backup.go:263 ./cli/app/backup.go:287 ./cli/app/env.go:333 ./cli/app/list.go:327 ./cli/app/logs.go:101 ./cli/app/new.go:368 ./cli/app/restore.go:114 ./cli/app/secret.go:535 ./cli/catalogue/catalogue.go:27 ./cli/catalogue/catalogue.go:310 ./cli/recipe/fetch.go:130 ./cli/server/server.go:12
+#: ./cli/app/backup.go:198 ./cli/app/backup.go:263 ./cli/app/backup.go:287 ./cli/app/env.go:333 ./cli/app/list.go:327 ./cli/app/logs.go:101 ./cli/app/new.go:372 ./cli/app/restore.go:114 ./cli/app/secret.go:535 ./cli/catalogue/catalogue.go:27 ./cli/catalogue/catalogue.go:310 ./cli/recipe/fetch.go:130 ./cli/server/server.go:12
 msgid   "s"
 msgstr  ""

@@ -4626,12 +4626,12 @@ msgstr  ""
 msgid   "secret not found: %s"
 msgstr  ""

-#: ./cli/app/deploy.go:358
+#: ./cli/app/deploy.go:359
 #, c-format
 msgid   "secret not generated: %s"
 msgstr  ""

-#: ./cli/app/deploy.go:356
+#: ./cli/app/deploy.go:357
 #, c-format
 msgid   "secret not inserted (#generate=false): %s"
 msgstr  ""
@@ -4641,27 +4641,27 @@ msgstr  ""
 msgid   "secret: %s removed"
 msgstr  ""

-#: ./cli/app/backup.go:302 ./cli/app/new.go:398
+#: ./cli/app/backup.go:302 ./cli/app/new.go:402
 msgid   "secrets"
 msgstr  ""

-#: ./cli/app/new.go:238
+#: ./cli/app/new.go:242
 #, c-format
 msgid   "secrets are %s shown again, please save them %s"
 msgstr  ""

-#: ./cli/app/deploy.go:306
+#: ./cli/app/deploy.go:307
 #, c-format
 msgid   "selected latest recipe version: %s (from %d available versions)"
 msgstr  ""

-#: ./cli/app/new.go:121
+#: ./cli/app/new.go:125
 #, c-format
 msgid   "selected recipe version: %s (from %d available versions)"
 msgstr  ""

 #. translators: `abra server` command for autocompletion
-#: ./cli/app/env.go:332 ./cli/app/env.go:339 ./cli/app/list.go:326 ./cli/app/list.go:341 ./cli/app/new.go:367 ./cli/app/new.go:374 ./cli/run.go:101
+#: ./cli/app/env.go:332 ./cli/app/env.go:339 ./cli/app/list.go:326 ./cli/app/list.go:341 ./cli/app/new.go:371 ./cli/app/new.go:378 ./cli/run.go:101
 msgid   "server"
 msgstr  ""

@@ -4775,7 +4775,7 @@ msgstr  ""
 msgid   "severity"
 msgstr  ""

-#: ./cli/app/deploy.go:456 ./cli/app/rollback.go:379 ./cli/app/upgrade.go:496
+#: ./cli/app/deploy.go:457 ./cli/app/rollback.go:380 ./cli/app/upgrade.go:497
 msgid   "show all configs & images, including unchanged ones"
 msgstr  ""

@@ -4799,7 +4799,7 @@ msgstr  ""
 msgid   "show debug messages"
 msgstr  ""

-#: ./cli/app/deploy.go:453 ./cli/app/rollback.go:376 ./cli/app/upgrade.go:493
+#: ./cli/app/deploy.go:454 ./cli/app/rollback.go:377 ./cli/app/upgrade.go:494
 msgid   "show-unchanged"
 msgstr  ""

@@ -4807,7 +4807,7 @@ msgstr  ""
 msgid   "since"
 msgstr  ""

-#: ./cli/app/new.go:336
+#: ./cli/app/new.go:340
 #, c-format
 msgid   "single server detected, choosing %s automatically"
 msgstr  ""
@@ -4847,11 +4847,11 @@ msgstr  ""
 msgid   "skipping converge logic checks"
 msgstr  ""

-#: ./cli/app/deploy.go:208
+#: ./cli/app/deploy.go:209
 msgid   "skipping domain checks"
 msgstr  ""

-#: ./cli/app/deploy.go:205
+#: ./cli/app/deploy.go:206
 msgid   "skipping domain checks, no DOMAIN=... configured"
 msgstr  ""

@@ -4865,17 +4865,17 @@ msgstr  ""
 msgid   "skipping secret (because it already exists) on %s: %s"
 msgstr  ""

-#: ./pkg/recipe/git.go:413
+#: ./pkg/recipe/git.go:419
 #, c-format
 msgid   "skipping tag %s: checkout failed: %s"
 msgstr  ""

-#: ./pkg/recipe/git.go:422
+#: ./pkg/recipe/git.go:428
 #, c-format
 msgid   "skipping tag %s: invalid compose config: %s"
 msgstr  ""

-#: ./pkg/recipe/git.go:432
+#: ./pkg/recipe/git.go:438
 #, c-format
 msgid   "skipping tag %s: invalid image reference in service %s: %s"
 msgstr  ""
@@ -4907,7 +4907,7 @@ msgstr  ""
 msgid   "specify secret value"
 msgstr  ""

-#: ./cli/app/new.go:370
+#: ./cli/app/new.go:374
 msgid   "specify server for new app"
 msgstr  ""

@@ -4965,7 +4965,7 @@ msgstr  ""
 msgid   "store generated secrets in a local pass store"
 msgstr  ""

-#: ./cli/app/new.go:393
+#: ./cli/app/new.go:397
 msgid   "store secrets in a local pass store"
 msgstr  ""

@@ -4978,7 +4978,7 @@ msgstr  ""
 msgid   "succeeded"
 msgstr  ""

-#: ./pkg/recipe/git.go:184
+#: ./pkg/recipe/git.go:185
 #, c-format
 msgid   "successfully checked %s out to %s in %s"
 msgstr  ""
@@ -5115,7 +5115,7 @@ msgstr  ""
 msgid   "trim input"
 msgstr  ""

-#: ./cli/app/new.go:263 ./pkg/app/app.go:141
+#: ./cli/app/new.go:267 ./pkg/app/app.go:141
 #, c-format
 msgid   "trimming %s to %s to avoid runtime limits"
 msgstr  ""
@@ -5138,17 +5138,17 @@ msgstr  ""
 msgid   "un"
 msgstr  ""

-#: ./pkg/recipe/git.go:193
+#: ./pkg/recipe/git.go:194
 #, c-format
 msgid   "unable to check git clean status in %s: %s"
 msgstr  ""

-#: ./pkg/recipe/git.go:262
+#: ./pkg/recipe/git.go:263
 #, c-format
 msgid   "unable to check out default branch in %s: %s"
 msgstr  ""

-#: ./pkg/git/clone.go:100
+#: ./pkg/git/clone.go:98
 #, c-format
 msgid   "unable to clean up git clone of %s: %s"
 msgstr  ""
@@ -5222,7 +5222,7 @@ msgstr  ""
 msgid   "unable to discover SSH remote for %s"
 msgstr  ""

-#: ./pkg/recipe/git.go:268
+#: ./pkg/recipe/git.go:274
 #, c-format
 msgid   "unable to fetch tags in %s: %s"
 msgstr  ""
@@ -5232,7 +5232,7 @@ msgstr  ""
 msgid   "unable to get container matching %s: %s"
 msgstr  ""

-#: ./pkg/recipe/git.go:280
+#: ./pkg/recipe/git.go:286
 #, c-format
 msgid   "unable to git pull in %s: %s"
 msgstr  ""
@@ -5261,12 +5261,12 @@ msgstr  ""
 msgid   "unable to look up server context for %s: %s"
 msgstr  ""

-#: ./cli/recipe/fetch.go:77 ./pkg/git/read.go:26 ./pkg/lint/recipe.go:491 ./pkg/recipe/git.go:242
+#: ./cli/recipe/fetch.go:77 ./pkg/git/read.go:26 ./pkg/lint/recipe.go:491 ./pkg/recipe/git.go:243
 #, c-format
 msgid   "unable to open %s: %s"
 msgstr  ""

-#: ./pkg/recipe/git.go:257
+#: ./pkg/recipe/git.go:258
 #, c-format
 msgid   "unable to open git work tree in %s: %s"
 msgstr  ""
@@ -5326,7 +5326,7 @@ msgstr  ""
 msgid   "unable to read new env %s: %s"
 msgstr  ""

-#: ./pkg/recipe/git.go:247
+#: ./pkg/recipe/git.go:248
 #, c-format
 msgid   "unable to read remotes in %s: %s"
 msgstr  ""
@@ -5361,7 +5361,7 @@ msgstr  ""
 msgid   "unable to reset commit after failed release attempt: %s"
 msgstr  ""

-#: ./pkg/recipe/git.go:166
+#: ./pkg/recipe/git.go:167
 #, c-format
 msgid   "unable to resolve '%s': %s"
 msgstr  ""
@@ -5653,27 +5653,27 @@ msgstr  ""
 msgid   "version wiped from %s.env"
 msgstr  ""

-#: ./cli/app/deploy.go:372
+#: ./cli/app/deploy.go:373
 #, c-format
 msgid   "version: taking chaos version: %s"
 msgstr  ""

-#: ./cli/app/deploy.go:398
+#: ./cli/app/deploy.go:399
 #, c-format
 msgid   "version: taking deployed version: %s"
 msgstr  ""

-#: ./cli/app/deploy.go:403
+#: ./cli/app/deploy.go:404
 #, c-format
 msgid   "version: taking new recipe version: %s"
 msgstr  ""

-#: ./cli/app/deploy.go:392
+#: ./cli/app/deploy.go:393
 #, c-format
 msgid   "version: taking version from .env file: %s"
 msgstr  ""

-#: ./cli/app/deploy.go:378
+#: ./cli/app/deploy.go:379
 #, c-format
 msgid   "version: taking version from cli arg: %s"
 msgstr  ""
@@ -5801,7 +5801,7 @@ msgstr  ""
 msgid   "writer: %v, "
 msgstr  ""

-#: ./cli/app/deploy.go:288 ./cli/app/new.go:251 ./cli/app/rollback.go:256 ./cli/app/undeploy.go:120 ./cli/app/upgrade.go:301
+#: ./cli/app/deploy.go:289 ./cli/app/new.go:255 ./cli/app/rollback.go:257 ./cli/app/undeploy.go:120 ./cli/app/upgrade.go:302
 #, c-format
 msgid   "writing recipe version failed: %s"
 msgstr  ""
@@ -16,6 +16,7 @@ import (
 	"coopcloud.tech/tagcmp"
 	"github.com/distribution/reference"
 	"github.com/go-git/go-git/v5"
+	gitCfg "github.com/go-git/go-git/v5/config"
 	"github.com/go-git/go-git/v5/plumbing"
 )

@@ -262,7 +263,12 @@ func (r Recipe) EnsureUpToDate() error {
 		return errors.New(i18n.G("unable to check out default branch in %s: %s", r.Dir, err))
 	}

-	fetchOpts := &git.FetchOptions{Tags: git.AllTags}
+	// the refspec is passed explicitly, because a repository cloned by an older abra has a
+	// single-branch refspec stored in its config and would otherwise never see other branches
+	fetchOpts := &git.FetchOptions{
+		Tags:     git.AllTags,
+		RefSpecs: []gitCfg.RefSpec{"+refs/heads/*:refs/remotes/origin/*"},
+	}
 	if err := repo.Fetch(fetchOpts); err != nil {
 		if !strings.Contains(err.Error(), "already up-to-date") {
 			return errors.New(i18n.G("unable to fetch tags in %s: %s", r.Dir, err))
@@ -3,7 +3,7 @@ version: "3.8"

 services:
  app:
-    image: nginx:1.21.0
+    image: nginx:1.31.6
    secrets:
      - test_pass_one
      - test_pass_two
@@ -61,6 +61,16 @@ teardown(){
  run grep -q "TYPE=$TEST_RECIPE:0.3.0+1.21.0" \
    "$ABRA_DIR/servers/$TEST_SERVER/$TEST_APP_DOMAIN.env"
  assert_success
+
+  # 0.3.0-only
+  run grep -q "NETWORK_WITH_COMMENT=BAZ" \
+    "$ABRA_DIR/servers/$TEST_SERVER/$TEST_APP_DOMAIN.env"
+  assert_success
+
+  # latest-only
+  run grep -q "TIMEOUT=120" \
+    "$ABRA_DIR/servers/$TEST_SERVER/$TEST_APP_DOMAIN.env"
+  assert_failure
 }

@test "ensure recipe is up-to-date" {
@@ -100,6 +110,49 @@ teardown(){
  run grep -q "TYPE=$TEST_RECIPE:${tagHash}" \
    "$ABRA_DIR/servers/$TEST_SERVER/$TEST_APP_DOMAIN.env"
  assert_success
+
+  # 0.3.0-only
+  run grep -q "NETWORK_WITH_COMMENT=BAZ" \
+    "$ABRA_DIR/servers/$TEST_SERVER/$TEST_APP_DOMAIN.env"
+  assert_success
+
+  # latest-only
+  run grep -q "TIMEOUT=120" \
+    "$ABRA_DIR/servers/$TEST_SERVER/$TEST_APP_DOMAIN.env"
+  assert_failure
+}
+
+@test "create new app with commit from another branch" {
+  branchHash=$(_get_other_branch_hash)
+  if [[ -z "$branchHash" ]]; then
+    skip "$TEST_RECIPE has no branch besides main"
+  fi
+
+  # re-clone the recipe the way an older abra did, with a single-branch refspec. --no-local
+  # forces a real transfer, a local clone would hardlink the whole object database and leave
+  # the commit reachable
+  run rm -rf "$ABRA_DIR/recipes/$TEST_RECIPE"
+  assert_success
+
+  run git clone -q --no-local --single-branch --branch main \
+    "$ABRA_DIR/origin-recipes/$TEST_RECIPE.git" "$ABRA_DIR/recipes/$TEST_RECIPE"
+  assert_success
+
+  # the commit has to be genuinely missing, otherwise this test passes for the wrong reason
+  run git -C "$ABRA_DIR/recipes/$TEST_RECIPE" rev-parse --verify "$branchHash^{commit}"
+  assert_failure
+
+  run $ABRA app new "$TEST_RECIPE" "$branchHash" \
+    --no-input \
+    --server "$TEST_SERVER" \
+    --domain "$TEST_APP_DOMAIN"
+  assert_success
+  assert_exists "$ABRA_DIR/servers/$TEST_SERVER/$TEST_APP_DOMAIN.env"
+
+  # the recipe names itself in TYPE, which differs per branch, so only the version is checked
+  run grep -q "TYPE=.*:${branchHash}$" \
+    "$ABRA_DIR/servers/$TEST_SERVER/$TEST_APP_DOMAIN.env"
+  assert_success
 }

@test "does not overwrite existing env files" {
@@ -56,6 +56,13 @@ _get_tag_hash() {
  echo $(git -C "$ABRA_DIR/recipes/$TEST_RECIPE" rev-list -n 1 "$1")
 }

+_get_other_branch_hash() {
+  # asked from the origin mirror, not from the recipe checkout, so that the result does not
+  # depend on what has been fetched. empty when the recipe only has a default branch
+  echo $(git ls-remote "$ABRA_DIR/origin-recipes/$TEST_RECIPE.git" \
+    | grep 'refs/heads/' | grep -v 'refs/heads/main$' | head -1 | cut -f1)
+}
+
 _get_head_hash() {
  echo $(git -C "$ABRA_DIR/recipes/$TEST_RECIPE" show -s --format="%H" HEAD)
 }
@@ -3,7 +3,7 @@ version: "3.8"

 services:
  app:
-    image: nginx:1.29.0
+    image: nginx:1.31.6
    networks:
      - proxy
    deploy:
@@ -3,16 +3,16 @@ kind: pipeline
 name: coopcloud.tech/tagcmp
 steps:
  - name: gofmt
-    image: golang:1.21
+    image: golang:1.27
    commands:
      - test -z "$(gofmt -l .)"

  - name: go build
-    image: golang:1.21
+    image: golang:1.27
    commands:
      - go build -v .

  - name: go test
-    image: golang:1.21
+    image: golang:1.27
    commands:
      - go test . -cover
@@ -0,0 +1,6 @@
+{
+  "$schema": "https://docs.renovatebot.com/renovate-schema.json",
+  "extends": [
+    "config:recommended"
+  ]
+}
@@ -5,6 +5,10 @@ Billy implements an interface based on the `os` standard library, allowing to de

 Billy was born as part of [go-git/go-git](https://github.com/go-git/go-git) project.

+## Version support
+
+go-billy v5 is in maintenance mode. Users should upgrade to [go-billy v6](https://pkg.go.dev/github.com/go-git/go-billy/v6) where possible.
+
 ## Installation

 ```go
@@ -3,19 +3,25 @@ package chroot
 import (
 	"errors"
 	"os"
+	"path"
 	"path/filepath"
 	"strings"
+	"syscall"

 	"github.com/go-git/go-billy/v5"
 	"github.com/go-git/go-billy/v5/helper/polyfill"
 )

 // ChrootHelper is a helper to implement billy.Chroot.
+// It is not a security boundary, callers that need containment should use a
+// filesystem implementation that enforces paths at the OS boundary instead.
 type ChrootHelper struct {
 	underlying billy.Filesystem
 	base       string
 }

+const maxFollowedSymlinks = 8 // Aligns with POSIX_SYMLOOP_MAX
+
 // New creates a new filesystem wrapping up the given 'fs'.
 // The created filesystem has its base in the given ChrootHelperectory of the
 // underlying filesystem.
@@ -34,15 +40,184 @@ func (fs *ChrootHelper) underlyingPath(filename string) (string, error) {
 	return fs.Join(fs.Root(), filename), nil
 }

-func isCrossBoundaries(path string) bool {
-	path = filepath.ToSlash(path)
-	path = filepath.Clean(path)
+func (fs *ChrootHelper) followedPath(filename string, followFinal bool, op string) (string, error) {
+	fullpath, err := fs.underlyingPath(filename)
+	if err != nil {
+		return "", err
+	}

-	return strings.HasPrefix(path, ".."+string(filepath.Separator))
+	sl, ok := fs.underlying.(billy.Symlink)
+	if !ok {
+		return fullpath, nil
+	}
+
+	rel, err := fs.relativeToRoot(fullpath)
+	if err != nil {
+		return "", err
+	}
+
+	fullpath, err = fs.resolveFollowedPath(rel, followFinal, op, sl)
+	if errors.Is(err, billy.ErrNotSupported) {
+		return fs.underlyingPath(filename)
+	}
+
+	return fullpath, err
+}
+
+func (fs *ChrootHelper) resolveFollowedPath(rel string, followFinal bool, op string, sl billy.Symlink) (string, error) {
+	if rel == "" {
+		return fs.resolveFollowedRoot(followFinal, op, sl)
+	}
+
+	parts := splitRelativePath(rel)
+	resolved := ""
+	followed := 0
+
+	for len(parts) > 0 {
+		part := parts[0]
+		parts = parts[1:]
+
+		currentRel := joinRelativePath(resolved, part)
+		currentPath := fs.Join(fs.Root(), currentRel)
+		if len(parts) == 0 && !followFinal {
+			return currentPath, nil
+		}
+
+		fi, err := sl.Lstat(currentPath)
+		if err != nil {
+			if os.IsNotExist(err) {
+				return fs.Join(fs.Root(), joinRelativePath(append([]string{currentRel}, parts...)...)), nil
+			}
+			return "", err
+		}
+
+		if fi.Mode()&os.ModeSymlink == 0 {
+			resolved = currentRel
+			continue
+		}
+
+		followed++
+		if followed > maxFollowedSymlinks {
+			return "", symlinkLoopError(op, currentPath)
+		}
+
+		target, err := sl.Readlink(currentPath)
+		if err != nil {
+			return "", err
+		}
+
+		targetRel, err := fs.linkTargetRel(currentPath, target)
+		if err != nil {
+			return "", err
+		}
+		if targetRel == currentRel {
+			return "", symlinkLoopError(op, currentPath)
+		}
+
+		parts = append(splitRelativePath(targetRel), parts...)
+		resolved = ""
+	}
+
+	return fs.Join(fs.Root(), resolved), nil
+}
+
+func symlinkLoopError(op, path string) error {
+	return &os.PathError{Op: op, Path: path, Err: syscall.ELOOP}
+}
+
+func (fs *ChrootHelper) resolveFollowedRoot(followFinal bool, op string, sl billy.Symlink) (string, error) {
+	root := fs.Join(fs.Root(), "")
+	if !followFinal {
+		return root, nil
+	}
+
+	fi, err := sl.Lstat(root)
+	if err != nil {
+		if os.IsNotExist(err) {
+			return root, nil
+		}
+		return "", err
+	}
+
+	if fi.Mode()&os.ModeSymlink == 0 {
+		return root, nil
+	}
+
+	target, err := sl.Readlink(root)
+	if err != nil {
+		return "", err
+	}
+
+	targetRel, err := fs.linkTargetRel(root, target)
+	if err != nil {
+		return root, err
+	}
+	if targetRel == "" {
+		return "", symlinkLoopError(op, root)
+	}
+
+	return fs.resolveFollowedPath(targetRel, followFinal, op, sl)
+}
+
+func (fs *ChrootHelper) relativeToRoot(filename string) (string, error) {
+	rel, err := filepath.Rel(filepath.Clean(fs.Root()), filepath.Clean(filename))
+	if err != nil || isCrossBoundaries(rel) {
+		return "", billy.ErrCrossedBoundary
+	}
+
+	if rel == "." {
+		return "", nil
+	}
+	return rel, nil
+}
+
+func (fs *ChrootHelper) linkTargetRel(linkPath, target string) (string, error) {
+	target = filepath.FromSlash(target)
+	if filepath.IsAbs(target) || strings.HasPrefix(target, string(filepath.Separator)) {
+		return fs.relativeToRoot(target)
+	}
+
+	return fs.relativeToRoot(fs.Join(filepath.Dir(linkPath), target))
+}
+
+func splitRelativePath(filename string) []string {
+	filename = filepath.Clean(filename)
+	if filename == "" || filename == "." {
+		return nil
+	}
+
+	return strings.Split(filepath.ToSlash(filename), "/")
+}
+
+func joinRelativePath(elem ...string) string {
+	parts := make([]string, 0, len(elem))
+	for _, part := range elem {
+		if part == "" || part == "." {
+			continue
+		}
+		parts = append(parts, part)
+	}
+
+	if len(parts) == 0 {
+		return ""
+	}
+	return filepath.Join(parts...)
+}
+
+func isCreateExclusive(flag int) bool {
+	return flag&os.O_CREATE != 0 && flag&os.O_EXCL != 0
+}
+
+func isCrossBoundaries(name string) bool {
+	name = filepath.ToSlash(name)
+	name = strings.TrimLeft(name, "/")
+	name = path.Clean(name)
+
+	return name == ".." || strings.HasPrefix(name, "../")
 }

 func (fs *ChrootHelper) Create(filename string) (billy.File, error) {
-	fullpath, err := fs.underlyingPath(filename)
+	fullpath, err := fs.followedPath(filename, true, "create")
 	if err != nil {
 		return nil, err
 	}
@@ -56,7 +231,7 @@ func (fs *ChrootHelper) Create(filename string) (billy.File, error) {
 }

 func (fs *ChrootHelper) Open(filename string) (billy.File, error) {
-	fullpath, err := fs.underlyingPath(filename)
+	fullpath, err := fs.followedPath(filename, true, "open")
 	if err != nil {
 		return nil, err
 	}
@@ -70,7 +245,7 @@ func (fs *ChrootHelper) Open(filename string) (billy.File, error) {
 }

 func (fs *ChrootHelper) OpenFile(filename string, flag int, mode os.FileMode) (billy.File, error) {
-	fullpath, err := fs.underlyingPath(filename)
+	fullpath, err := fs.followedPath(filename, !isCreateExclusive(flag), "open")
 	if err != nil {
 		return nil, err
 	}
@@ -84,12 +259,16 @@ func (fs *ChrootHelper) OpenFile(filename string, flag int, mode os.FileMode) (b
 }

 func (fs *ChrootHelper) Stat(filename string) (os.FileInfo, error) {
-	fullpath, err := fs.underlyingPath(filename)
+	fullpath, err := fs.followedPath(filename, true, "stat")
 	if err != nil {
 		return nil, err
 	}

-	return fs.underlying.Stat(fullpath)
+	fi, err := fs.underlying.Stat(fullpath)
+	if err != nil {
+		return nil, err
+	}
+	return fileInfo{FileInfo: fi, name: filepath.Base(filename)}, nil
 }

 func (fs *ChrootHelper) Rename(from, to string) error {
@@ -135,7 +314,7 @@ func (fs *ChrootHelper) TempFile(dir, prefix string) (billy.File, error) {
 }

 func (fs *ChrootHelper) ReadDir(path string) ([]os.FileInfo, error) {
-	fullpath, err := fs.underlyingPath(path)
+	fullpath, err := fs.followedPath(path, true, "readdir")
 	if err != nil {
 		return nil, err
 	}
@@ -241,6 +420,11 @@ type file struct {
 	name string
 }

+type fileInfo struct {
+	os.FileInfo
+	name string
+}
+
 func newFile(fs billy.Filesystem, f billy.File, filename string) billy.File {
 	filename = fs.Join(fs.Root(), filename)
 	filename, _ = filepath.Rel(fs.Root(), filename)
@@ -254,3 +438,7 @@ func newFile(fs billy.Filesystem, f billy.File, filename string) billy.File {
 func (f *file) Name() string {
 	return f.name
 }
+
+func (fi fileInfo) Name() string {
+	return fi.name
+}
@@ -24,6 +24,9 @@ var Default = &ChrootOS{}
 // New returns a new OS filesystem.
 // By default paths are deduplicated, but still enforced
 // under baseDir. For more info refer to WithDeduplicatePath.
+//
+// New returns ChrootOS by default for v5 compatibility. Users should prefer
+// New with WithBoundOS.
 func New(baseDir string, opts ...Option) billy.Filesystem {
 	o := &options{
 		deduplicatePath: true,
@@ -47,6 +50,8 @@ func WithBoundOS() Option {
 }

 // WithChrootOS returns the option of using a Chroot filesystem OS.
+//
+// Deprecated: use WithBoundOS instead.
 func WithChrootOS() Option {
 	return func(o *options) {
 		o.Type = ChrootOSFS
@@ -20,6 +20,7 @@
 package osfs

 import (
+	"errors"
 	"fmt"
 	"os"
 	"path/filepath"
@@ -29,6 +30,31 @@ import (
 	"github.com/go-git/go-billy/v5"
 )

+var (
+	// ErrBaseDirCannotBeRemoved is returned when removing the BoundOS base dir.
+	ErrBaseDirCannotBeRemoved = errors.New("base dir cannot be removed")
+
+	// ErrBaseDirCannotBeRenamed is returned when renaming the BoundOS base dir.
+	ErrBaseDirCannotBeRenamed = errors.New("base dir cannot be renamed")
+
+	dotPrefixes   = dotPathPrefixes()
+	dotSeparators = dotPathSeparators()
+)
+
+func dotPathPrefixes() []string {
+	if filepath.Separator == '\\' {
+		return []string{"./", ".\\"}
+	}
+	return []string{"./"}
+}
+
+func dotPathSeparators() string {
+	if filepath.Separator == '\\' {
+		return `/\`
+	}
+	return `/`
+}
+
 // BoundOS is a fs implementation based on the OS filesystem which is bound to
 // a base dir.
 // Prefer this fs implementation over ChrootOS.
@@ -54,6 +80,7 @@ func (fs *BoundOS) Create(filename string) (billy.File, error) {
 }

 func (fs *BoundOS) OpenFile(filename string, flag int, perm os.FileMode) (billy.File, error) {
+	filename = fs.expandDot(filename)
 	fn, err := fs.abs(filename)
 	if err != nil {
 		return nil, err
@@ -62,6 +89,7 @@ func (fs *BoundOS) OpenFile(filename string, flag int, perm os.FileMode) (billy.
 }

 func (fs *BoundOS) ReadDir(path string) ([]os.FileInfo, error) {
+	path = fs.expandDot(path)
 	dir, err := fs.abs(path)
 	if err != nil {
 		return nil, err
@@ -71,6 +99,12 @@ func (fs *BoundOS) ReadDir(path string) ([]os.FileInfo, error) {
 }

 func (fs *BoundOS) Rename(from, to string) error {
+	if fs.isBaseDir(from) {
+		return ErrBaseDirCannotBeRenamed
+	}
+	from = fs.expandDot(from)
+	to = fs.expandDot(to)
+
 	f, err := fs.abs(from)
 	if err != nil {
 		return err
@@ -89,6 +123,7 @@ func (fs *BoundOS) Rename(from, to string) error {
 }

 func (fs *BoundOS) MkdirAll(path string, perm os.FileMode) error {
+	path = fs.expandDot(path)
 	dir, err := fs.abs(path)
 	if err != nil {
 		return err
@@ -101,6 +136,7 @@ func (fs *BoundOS) Open(filename string) (billy.File, error) {
 }

 func (fs *BoundOS) Stat(filename string) (os.FileInfo, error) {
+	filename = fs.expandDot(filename)
 	filename, err := fs.abs(filename)
 	if err != nil {
 		return nil, err
@@ -109,6 +145,11 @@ func (fs *BoundOS) Stat(filename string) (os.FileInfo, error) {
 }

 func (fs *BoundOS) Remove(filename string) error {
+	if fs.isBaseDir(filename) {
+		return ErrBaseDirCannotBeRemoved
+	}
+	filename = fs.expandDot(filename)
+
 	fn, err := fs.abs(filename)
 	if err != nil {
 		return err
@@ -122,6 +163,7 @@ func (fs *BoundOS) Remove(filename string) error {
 func (fs *BoundOS) TempFile(dir, prefix string) (billy.File, error) {
 	if dir != "" {
 		var err error
+		dir = fs.expandDot(dir)
 		dir, err = fs.abs(dir)
 		if err != nil {
 			return nil, err
@@ -144,6 +186,11 @@ func (fs *BoundOS) Join(elem ...string) string {
 }

 func (fs *BoundOS) RemoveAll(path string) error {
+	if fs.isBaseDir(path) {
+		return ErrBaseDirCannotBeRemoved
+	}
+	path = fs.expandDot(path)
+
 	dir, err := fs.abs(path)
 	if err != nil {
 		return err
@@ -152,6 +199,7 @@ func (fs *BoundOS) RemoveAll(path string) error {
 }

 func (fs *BoundOS) Symlink(target, link string) error {
+	link = fs.expandDot(link)
 	ln, err := fs.abs(link)
 	if err != nil {
 		return err
@@ -164,6 +212,7 @@ func (fs *BoundOS) Symlink(target, link string) error {
 }

 func (fs *BoundOS) Lstat(filename string) (os.FileInfo, error) {
+	filename = fs.expandDot(filename)
 	filename = filepath.Clean(filename)
 	if !filepath.IsAbs(filename) {
 		filename = filepath.Join(fs.baseDir, filename)
@@ -175,6 +224,7 @@ func (fs *BoundOS) Lstat(filename string) (os.FileInfo, error) {
 }

 func (fs *BoundOS) Readlink(link string) (string, error) {
+	link = fs.expandDot(link)
 	if !filepath.IsAbs(link) {
 		link = filepath.Clean(filepath.Join(fs.baseDir, link))
 	}
@@ -185,6 +235,7 @@ func (fs *BoundOS) Readlink(link string) (string, error) {
 }

 func (fs *BoundOS) Chmod(path string, mode os.FileMode) error {
+	path = fs.expandDot(path)
 	abspath, err := fs.abs(path)
 	if err != nil {
 		return err
@@ -199,7 +250,7 @@ func (fs *BoundOS) Chroot(path string) (billy.Filesystem, error) {
 	if err != nil {
 		return nil, err
 	}
-	return New(joined), nil
+	return New(joined, WithBoundOS()), nil
 }

 // Root returns the current base dir of the billy.Filesystem.
@@ -220,6 +271,37 @@ func (fs *BoundOS) createDir(fullpath string) error {
 	return nil
 }

+func (fs *BoundOS) expandDot(path string) string {
+	if path == "." {
+		return fs.baseDir
+	}
+	for _, prefix := range dotPrefixes {
+		if strings.HasPrefix(path, prefix) {
+			path = strings.TrimLeft(strings.TrimPrefix(path, prefix), dotSeparators)
+			if path == "" {
+				return fs.baseDir
+			}
+			return path
+		}
+	}
+	return path
+}
+
+func (fs *BoundOS) isBaseDir(path string) bool {
+	if path == "" || filepath.Clean(path) == "." {
+		return true
+	}
+	path = fs.expandDot(path)
+	if filepath.Clean(path) == filepath.Clean(fs.baseDir) {
+		return true
+	}
+	abspath, err := fs.abs(path)
+	if err != nil {
+		return false
+	}
+	return filepath.Clean(abspath) == filepath.Clean(fs.baseDir)
+}
+
 // abs transforms filename to an absolute path, taking into account the base dir.
 // Relative paths won't be allowed to ascend the base dir, so `../file` will become
 // `/working-dir/file`.
@@ -233,7 +315,7 @@ func (fs *BoundOS) abs(filename string) (string, error) {

 	path, err := securejoin.SecureJoin(fs.baseDir, filename)
 	if err != nil {
-		return "", nil
+		return "", err
 	}

 	if fs.deduplicatePath {
@@ -246,24 +328,12 @@ func (fs *BoundOS) abs(filename string) (string, error) {
 	return path, nil
 }

-// insideBaseDir checks whether filename is located within
-// the fs.baseDir.
-func (fs *BoundOS) insideBaseDir(filename string) (bool, error) {
-	if filename == fs.baseDir {
-		return true, nil
-	}
-	if !strings.HasPrefix(filename, fs.baseDir+string(filepath.Separator)) {
-		return false, fmt.Errorf("path outside base dir")
-	}
-	return true, nil
-}
-
 // insideBaseDirEval checks whether filename is contained within
 // a dir that is within the fs.baseDir, by first evaluating any symlinks
 // that either filename or fs.baseDir may contain.
 func (fs *BoundOS) insideBaseDirEval(filename string) (bool, error) {
 	// "/" contains all others.
-	if fs.baseDir == "/" {
+	if fs.baseDir == "/" || fs.baseDir == filename {
 		return true, nil
 	}
 	dir, err := filepath.EvalSymlinks(filepath.Dir(filename))
@@ -14,6 +14,8 @@ import (
 // ChrootOS is a legacy filesystem based on a "soft chroot" of the os filesystem.
 // Although this is still the default os filesystem, consider using BoundOS instead.
 //
+// Deprecated: use New with WithBoundOS instead.
+//
 // Behaviours of note:
 //  1. A "soft chroot" translates the base dir to "/" for the purposes of the
 //     fs abstraction.
@@ -24,6 +26,14 @@ import (
 type ChrootOS struct{}

 func newChrootOS(baseDir string) billy.Filesystem {
+	if baseDir != "" {
+		resolved, err := filepath.EvalSymlinks(baseDir)
+		if err != nil {
+			return chroot.New(&ChrootOS{}, baseDir)
+		}
+		baseDir = resolved
+	}
+
 	return chroot.New(&ChrootOS{}, baseDir)
 }

@@ -16,8 +16,6 @@ import (
 // can but returns the first error it encounters. If the path does not exist,
 // RemoveAll returns nil (no error).
 func RemoveAll(fs billy.Basic, path string) error {
-	fs, path = getUnderlyingAndPath(fs, path)
-
 	if r, ok := fs.(removerAll); ok {
 		return r.RemoveAll(path)
 	}
@@ -39,7 +37,7 @@ func removeAll(fs billy.Basic, path string) error {
 	}

 	// Otherwise, is this a directory we need to recurse into?
-	dir, serr := fs.Stat(path)
+	dir, serr := lstat(fs, path)
 	if serr != nil {
 		if errors.Is(serr, os.ErrNotExist) {
 			return nil
@@ -48,8 +46,8 @@ func removeAll(fs billy.Basic, path string) error {
 		return serr
 	}

-	if !dir.IsDir() {
-		// Not a directory; return the error from Remove.
+	if dir.Mode()&os.ModeSymlink != 0 || !dir.IsDir() {
+		// Not a directory we should recurse into; return the error from Remove.
 		return err
 	}

@@ -62,7 +60,7 @@ func removeAll(fs billy.Basic, path string) error {
 	fis, err := dirfs.ReadDir(path)
 	if err != nil {
 		if errors.Is(err, os.ErrNotExist) {
-			// Race. It was deleted between the Lstat and Open.
+			// Race. It was deleted between the Lstat and ReadDir.
 			// Return nil per RemoveAll's docs.
 			return nil
 		}
@@ -91,7 +89,18 @@ func removeAll(fs billy.Basic, path string) error {
 	}

 	return err
+}

+func lstat(filesystem billy.Basic, path string) (os.FileInfo, error) {
+	if sl, ok := filesystem.(billy.Symlink); ok {
+		// Avoid following a symlink substituted after the initial Remove fails.
+		fi, err := sl.Lstat(path)
+		if err == nil || !errors.Is(err, billy.ErrNotSupported) {
+			return fi, err
+		}
+	}
+
+	return filesystem.Stat(path)
 }

 // WriteFile writes data to a file named by filename in the given filesystem.
@@ -123,8 +132,10 @@ func WriteFile(fs billy.Basic, filename string, data []byte, perm os.FileMode) (
 // We generate random temporary file names so that there's a good
 // chance the file doesn't exist yet - keeps the number of tries in
 // TempFile to a minimum.
-var rand uint32
-var randmu sync.Mutex
+var (
+	rand   uint32
+	randmu sync.Mutex
+)

 func reseed() uint32 {
 	return uint32(time.Now().UnixNano() + int64(os.Getpid()))
@@ -220,22 +231,6 @@ func getTempDir(fs billy.Basic) string {
 	return ".tmp"
 }

-type underlying interface {
-	Underlying() billy.Basic
-}
-
-func getUnderlyingAndPath(fs billy.Basic, path string) (billy.Basic, string) {
-	u, ok := fs.(underlying)
-	if !ok {
-		return fs, path
-	}
-	if ch, ok := fs.(billy.Chroot); ok {
-		path = fs.Join(ch.Root(), path)
-	}
-
-	return u.Underlying(), path
-}
-
 // ReadFile reads the named file and returns the contents from the given filesystem.
 // A successful call returns err == nil, not err == EOF.
 // Because ReadFile reads the whole file, it does not treat an EOF from Read
@@ -5,3 +5,4 @@ profile.out
 .tmp/
 .git-dist/
 .vscode
+build/tools/
@@ -61,6 +61,16 @@ type Config struct {
 		CommentChar string
 		// RepositoryFormatVersion identifies the repository format and layout version.
 		RepositoryFormatVersion format.RepositoryFormatVersion
+		// ProtectNTFS controls whether NTFS-specific path protections are
+		// applied (e.g. rejecting .git trailing spaces/periods, alternate
+		// data streams, 8.3 short names). When unset, defaults to true on
+		// Windows.
+		ProtectNTFS OptBool
+		// ProtectHFS controls whether HFS+-specific path protections are
+		// applied (e.g. rejecting .git with Unicode zero-width or
+		// directional characters that HFS+ would normalize away).
+		// When unset, defaults to true on macOS.
+		ProtectHFS OptBool
 	}

 	User struct {
@@ -266,6 +276,8 @@ const (
 	repositoryFormatVersionKey = "repositoryformatversion"
 	objectFormat               = "objectformat"
 	mirrorKey                  = "mirror"
+	protectNTFSKey             = "protectNTFS"
+	protectHFSKey              = "protectHFS"

 	// DefaultPackWindow holds the number of previous objects used to
 	// generate deltas. The value 10 is the same used by git command.
@@ -309,6 +321,18 @@ func (c *Config) unmarshalCore() {

 	c.Core.Worktree = s.Options.Get(worktreeKey)
 	c.Core.CommentChar = s.Options.Get(commentCharKey)
+
+	if parsed := parseConfigBool(s.Options.Get(protectNTFSKey)); parsed.IsSet() {
+		c.Core.ProtectNTFS = parsed
+	}
+
+	if parsed := parseConfigBool(s.Options.Get(protectHFSKey)); parsed.IsSet() {
+		c.Core.ProtectHFS = parsed
+	}
+
+	if s.Options.Get(repositoryFormatVersionKey) == string(format.Version_1) {
+		c.Core.RepositoryFormatVersion = format.Version_1
+	}
 }

 func (c *Config) unmarshalUser() {
@@ -379,7 +403,8 @@ func unmarshalSubmodules(fc *format.Config, submodules map[string]*Submodule) {
 		m := &Submodule{}
 		m.unmarshal(sub)

-		if m.Validate() == ErrModuleBadPath {
+		if err := m.Validate(); errors.Is(err, ErrModuleBadPath) ||
+			errors.Is(err, ErrModuleBadName) {
 			continue
 		}

@@ -436,6 +461,14 @@ func (c *Config) marshalCore() {
 	if c.Core.Worktree != "" {
 		s.SetOption(worktreeKey, c.Core.Worktree)
 	}
+
+	if c.Core.ProtectNTFS.IsSet() {
+		s.SetOption(protectNTFSKey, c.Core.ProtectNTFS.FormatBool())
+	}
+
+	if c.Core.ProtectHFS.IsSet() {
+		s.SetOption(protectHFSKey, c.Core.ProtectHFS.FormatBool())
+	}
 }

 func (c *Config) marshalExtensions() {
@@ -3,8 +3,11 @@ package config
 import (
 	"bytes"
 	"errors"
+	"fmt"
 	"regexp"
+	"strings"

+	"github.com/go-git/go-git/v5/internal/pathutil"
 	format "github.com/go-git/go-git/v5/plumbing/format/config"
 )

@@ -12,6 +15,7 @@ var (
 	ErrModuleEmptyURL  = errors.New("module config: empty URL")
 	ErrModuleEmptyPath = errors.New("module config: empty path")
 	ErrModuleBadPath   = errors.New("submodule has an invalid path")
+	ErrModuleBadName   = errors.New("ignoring suspicious submodule name")
 )

 var (
@@ -94,6 +98,10 @@ type Submodule struct {

 // Validate validates the fields and sets the default values.
 func (m *Submodule) Validate() error {
+	if err := validSubmoduleName(m.Name); err != nil {
+		return fmt.Errorf("%w: %q", ErrModuleBadName, m.Name)
+	}
+
 	if m.Path == "" {
 		return ErrModuleEmptyPath
 	}
@@ -109,6 +117,50 @@ func (m *Submodule) Validate() error {
 	return nil
 }

+// validSubmoduleName mirrors canonical Git's check_submodule_name in
+// submodule-config.c [1]: reject empty names and any name with a ".."
+// path component, using both '/' and '\\' as separators so the rule
+// is consistent across platforms. The component check is delegated to
+// `pathutil.IsHFSDot` and `pathutil.IsNTFSDot` with `.` as the needle,
+// which both cover the bare ".." case and reject components that
+// resolve to ".." after HFS+ Unicode normalisation (ignored code
+// points, e.g. `.<U+200C>.`) or NTFS trailing-space/dot/ADS
+// canonicalisation (e.g. `.. `, `..::$INDEX_ALLOCATION`).
+// `.gitmodules` is attacker-controlled by definition, so both checks
+// run unconditionally regardless of host OS.
+//
+// The additional checks (bare ".", NUL byte, leading or trailing
+// separator, drive-letter prefix) close go-git-specific edge cases
+// the canonical loop does not exercise: canonical Git treats names
+// as opaque C strings, while Go strings carry NULs through and the
+// billy filesystem layer is path-aware in ways Git's working storage
+// is not.
+//
+// [1]: https://github.com/git/git/blob/v2.54.0/submodule-config.c#L214-L237
+func validSubmoduleName(name string) error {
+	if name == "" || name == "." {
+		return ErrModuleBadName
+	}
+	for _, seg := range strings.FieldsFunc(name, isPathSep) {
+		if pathutil.IsHFSDot(seg, ".") || pathutil.IsNTFSDot(seg, ".", "") {
+			return ErrModuleBadName
+		}
+	}
+	// go-git-specific defensive checks beyond canonical Git.
+	if strings.ContainsRune(name, 0) {
+		return ErrModuleBadName
+	}
+	if isPathSep(rune(name[0])) || isPathSep(rune(name[len(name)-1])) {
+		return ErrModuleBadName
+	}
+	if len(name) >= 2 && name[1] == ':' {
+		return ErrModuleBadName
+	}
+	return nil
+}
+
+func isPathSep(r rune) bool { return r == '/' || r == '\\' }
+
 func (m *Submodule) unmarshal(s *format.Subsection) {
 	m.raw = s

@@ -0,0 +1,82 @@
+package config
+
+import (
+	"strconv"
+	"strings"
+)
+
+// OptBool is a tri-state boolean: unset, explicitly false, or explicitly true.
+// Its zero value (OptBoolUnset) means the setting was not specified, which
+// allows merge logic based on reflect.Value.IsZero to skip unset fields while
+// still letting an explicit "false" override a previously set "true".
+type OptBool byte
+
+const (
+	// OptBoolUnset indicates the setting was not specified.
+	OptBoolUnset OptBool = iota
+	// OptBoolFalse indicates the setting was explicitly set to false.
+	OptBoolFalse
+	// OptBoolTrue indicates the setting was explicitly set to true.
+	OptBoolTrue
+)
+
+// NewOptBool converts a plain bool into an OptBool.
+func NewOptBool(v bool) OptBool {
+	if v {
+		return OptBoolTrue
+	}
+	return OptBoolFalse
+}
+
+// IsTrue returns whether the value is explicitly true.
+func (o OptBool) IsTrue() bool { return o == OptBoolTrue }
+
+// IsSet returns whether the value was explicitly specified (true or false).
+func (o OptBool) IsSet() bool { return o != OptBoolUnset }
+
+func (o OptBool) String() string {
+	switch o {
+	case OptBoolTrue:
+		return "true"
+	case OptBoolFalse:
+		return "false"
+	default:
+		return "unset"
+	}
+}
+
+// FormatBool returns the strconv-formatted value. Only meaningful when IsSet.
+func (o OptBool) FormatBool() string {
+	return strconv.FormatBool(o.IsTrue())
+}
+
+// parseConfigBool mirrors upstream Git's git_parse_maybe_bool: it
+// accepts true/yes/on (→ OptBoolTrue) and false/no/off (→
+// OptBoolFalse) case-insensitively, plus any decimal integer (zero
+// → OptBoolFalse, non-zero → OptBoolTrue). Empty or otherwise
+// unrecognised values return OptBoolUnset, leaving the caller's
+// platform default in place. The empty-string handling is the only
+// intentional divergence from upstream, which returns false for
+// empty: in our unmarshalCore caller, an empty value means the key
+// is unset and the platform default should apply.
+//
+// Reference: upstream Git git_parse_maybe_bool_text at parse.c
+// L157-L173 and git_parse_maybe_bool at parse.c L174-L182 in tag
+// v2.54.0[1].
+//
+// [1]: https://github.com/git/git/blob/v2.54.0/parse.c#L157-L182
+func parseConfigBool(v string) OptBool {
+	switch strings.ToLower(v) {
+	case "true", "yes", "on":
+		return OptBoolTrue
+	case "false", "no", "off":
+		return OptBoolFalse
+	}
+	if i, err := strconv.Atoi(v); err == nil {
+		if i != 0 {
+			return OptBoolTrue
+		}
+		return OptBoolFalse
+	}
+	return OptBoolUnset
+}
@@ -0,0 +1,21 @@
+package pathutil
+
+import "strings"
+
+// IsDotGitName reports whether name is `.git` or its 8.3 NTFS short
+// alias `git~1`, case-insensitively. Both are forbidden as path
+// components (and as submodule names) because they refer to the
+// repository's own metadata directory.
+//
+// File names that do not conform to the 8.3 format (up to eight
+// characters for the basename, three for the file extension) are
+// associated with a so-called "short name" on NTFS — at least on
+// the `C:` drive by default — which means that `git~1/` is a valid
+// way to refer to `.git/`.
+func IsDotGitName(name string) bool {
+	switch strings.ToLower(name) {
+	case ".git", "git~1":
+		return true
+	}
+	return false
+}
@@ -0,0 +1,99 @@
+package pathutil
+
+import "unicode"
+
+// hfsIgnoredCodepoints contains Unicode code points that HFS+ ignores
+// during path normalization. A path component containing these
+// characters between the bytes of ".git" (or ".gitmodules", etc.)
+// will be treated as that name by HFS+, so they have to be filtered
+// out before comparison.
+//
+// See upstream Git utf8.c next_hfs_char in tag v2.54.0[1].
+//
+// [1]: https://github.com/git/git/blob/v2.54.0/utf8.c#L703-L740
+var hfsIgnoredCodepoints = map[rune]struct{}{
+	0x200c: {}, // ZERO WIDTH NON-JOINER
+	0x200d: {}, // ZERO WIDTH JOINER
+	0x200e: {}, // LEFT-TO-RIGHT MARK
+	0x200f: {}, // RIGHT-TO-LEFT MARK
+	0x202a: {}, // LEFT-TO-RIGHT EMBEDDING
+	0x202b: {}, // RIGHT-TO-LEFT EMBEDDING
+	0x202c: {}, // POP DIRECTIONAL FORMATTING
+	0x202d: {}, // LEFT-TO-RIGHT OVERRIDE
+	0x202e: {}, // RIGHT-TO-LEFT OVERRIDE
+	0x206a: {}, // INHIBIT SYMMETRIC SWAPPING
+	0x206b: {}, // ACTIVATE SYMMETRIC SWAPPING
+	0x206c: {}, // INHIBIT ARABIC FORM SHAPING
+	0x206d: {}, // ACTIVATE ARABIC FORM SHAPING
+	0x206e: {}, // NATIONAL DIGIT SHAPES
+	0x206f: {}, // NOMINAL DIGIT SHAPES
+	0xfeff: {}, // ZERO WIDTH NO-BREAK SPACE
+}
+
+// IsHFSDot reports whether part would be treated as ".<needle>" on an
+// HFS+ filesystem after stripping ignored Unicode code points and
+// folding ASCII to lower case. The needle is the lowercase ASCII
+// suffix without the leading dot (e.g. "git", "gitmodules"). It
+// mirrors upstream Git's is_hfs_dot_generic and is the building
+// block of IsHFSDotGit / IsHFSDotGitmodules.
+//
+// Reference: upstream Git utf8.c is_hfs_dot_generic at L741-L774 and
+// the dotgit family at L784-L809 in tag v2.54.0[1].
+//
+// [1]: https://github.com/git/git/blob/v2.54.0/utf8.c#L741-L809
+func IsHFSDot(part, needle string) bool {
+	runes := []rune(part)
+	i := 0
+
+	// skip ignored code points, then expect '.'
+	for i < len(runes) {
+		if _, ok := hfsIgnoredCodepoints[runes[i]]; !ok {
+			break
+		}
+		i++
+	}
+	if i >= len(runes) || runes[i] != '.' {
+		return false
+	}
+	i++
+
+	// match needle case-insensitively, skipping ignored code points
+	for _, expected := range needle {
+		for i < len(runes) {
+			if _, ok := hfsIgnoredCodepoints[runes[i]]; !ok {
+				break
+			}
+			i++
+		}
+		if i >= len(runes) {
+			return false
+		}
+		r := runes[i]
+		if r > 127 {
+			return false
+		}
+		if unicode.ToLower(r) != expected {
+			return false
+		}
+		i++
+	}
+
+	// skip trailing ignored code points
+	for i < len(runes) {
+		if _, ok := hfsIgnoredCodepoints[runes[i]]; !ok {
+			break
+		}
+		i++
+	}
+
+	// must be at end of component
+	return i == len(runes)
+}
+
+// IsHFSDotGit reports whether part is an HFS+ equivalent of ".git".
+func IsHFSDotGit(part string) bool { return IsHFSDot(part, "git") }
+
+// IsHFSDotGitmodules reports whether part is an HFS+ equivalent of
+// ".gitmodules", catching attempts to plant the file via Unicode
+// code points that HFS+ would strip during normalisation.
+func IsHFSDotGitmodules(part string) bool { return IsHFSDot(part, "gitmodules") }
@@ -0,0 +1,187 @@
+package pathutil
+
+import "strings"
+
+// IsNTFSDotGit ports upstream Git's is_ntfs_dotgit. It detects path
+// components that NTFS would resolve to ".git": the canonical name
+// itself and its 8.3 short-name alias "git~1", each followed by any
+// number of trailing spaces or periods (which NTFS silently trims)
+// and an optional Alternate Data Stream suffix (":<stream>"). The
+// bare strings ".git" and "git~1" also match, mirroring upstream.
+//
+// Reference: upstream Git path.c is_ntfs_dotgit at L1415-L1449
+// in tag v2.54.0[1].
+//
+// [1]: https://github.com/git/git/blob/v2.54.0/path.c#L1415-L1449
+func IsNTFSDotGit(part string) bool {
+	var i int
+	switch {
+	case len(part) >= 4 && part[0] == '.' &&
+		asciiToLower(part[1]) == 'g' &&
+		asciiToLower(part[2]) == 'i' &&
+		asciiToLower(part[3]) == 't':
+		i = 4
+	case len(part) >= 5 &&
+		asciiToLower(part[0]) == 'g' &&
+		asciiToLower(part[1]) == 'i' &&
+		asciiToLower(part[2]) == 't' &&
+		part[3] == '~' && part[4] == '1':
+		i = 5
+	default:
+		return false
+	}
+
+	for ; i < len(part); i++ {
+		c := part[i]
+		if c == ':' {
+			return true
+		}
+		if c != '.' && c != ' ' {
+			return false
+		}
+	}
+	return true
+}
+
+// WindowsValidPath reports whether part is a valid Windows / NTFS
+// path component for the worktree filesystem abstraction. It rejects
+// NTFS-disguised variants of `.git` and `git~1` (trailing spaces,
+// periods, Alternate Data Streams) and Windows reserved device
+// names. Bare `.git` and `git~1` are allowed at this layer; the
+// caller decides whether they are permissible at the current path
+// position.
+func WindowsValidPath(part string) bool {
+	if IsNTFSDotGit(part) && !IsDotGitName(part) {
+		return false
+	}
+	return !isWindowsReservedName(part)
+}
+
+// windowsReservedNames lists the Windows reserved device names.
+// A path component is reserved if its base name (ignoring trailing
+// spaces, extensions, and NTFS Alternate Data Streams) matches one of
+// these case-insensitively.
+//
+// See upstream Git compat/mingw.c is_valid_win32_path().
+var windowsReservedNames = []string{
+	"CON", "PRN", "AUX", "NUL",
+	"COM1", "COM2", "COM3", "COM4", "COM5", "COM6", "COM7", "COM8", "COM9",
+	"LPT1", "LPT2", "LPT3", "LPT4", "LPT5", "LPT6", "LPT7", "LPT8", "LPT9",
+	"CONIN$", "CONOUT$",
+}
+
+func isWindowsReservedName(part string) bool {
+	for _, name := range windowsReservedNames {
+		if len(part) < len(name) {
+			continue
+		}
+		if !strings.EqualFold(part[:len(name)], name) {
+			continue
+		}
+		// Exact match or followed by space, dot, colon (ADS), or separator.
+		if len(part) == len(name) {
+			return true
+		}
+		switch part[len(name)] {
+		case ' ', '.', ':':
+			return true
+		}
+	}
+	return false
+}
+
+// IsNTFSDot ports upstream Git's is_ntfs_dot_generic. It detects NTFS
+// path-component variants of a dotfile name that attackers can use to
+// bypass case-insensitive comparisons against the canonical name on
+// Windows. The dotgit parameter is the lowercase name without the
+// leading dot (e.g. "gitmodules"); shortnamePrefix is the canonical
+// 6-character NTFS short-name prefix used as a fall-back match
+// (e.g. "gi7eba" for ".gitmodules").
+//
+// Reference: upstream Git path.c is_ntfs_dot_generic at L1451-L1507
+// in tag v2.54.0[1].
+//
+// [1]: https://github.com/git/git/blob/v2.54.0/path.c#L1451-L1507
+func IsNTFSDot(name, dotgit, shortnamePrefix string) bool {
+	// onlySpacesAndPeriods returns true when the suffix from start
+	// onwards consists only of trailing spaces and periods, possibly
+	// terminated by a NTFS Alternate Data Stream colon. Mirrors the
+	// only_spaces_and_periods label in upstream's is_ntfs_dot_generic.
+	onlySpacesAndPeriods := func(start int) bool {
+		for i := start; i < len(name); i++ {
+			c := name[i]
+			if c == ':' {
+				return true
+			}
+			if c != ' ' && c != '.' {
+				return false
+			}
+		}
+		return true
+	}
+
+	// Pattern 1: ".<dotgit>" prefix + trailing spaces / periods / ADS.
+	if len(name) >= len(dotgit)+1 && name[0] == '.' &&
+		strings.EqualFold(name[1:1+len(dotgit)], dotgit) {
+		if onlySpacesAndPeriods(len(dotgit) + 1) {
+			return true
+		}
+	}
+
+	// Pattern 2: standard NTFS short name <dotgit[:6]>~[1-4].
+	if len(dotgit) >= 6 && len(name) >= 8 &&
+		strings.EqualFold(name[:6], dotgit[:6]) &&
+		name[6] == '~' && name[7] >= '1' && name[7] <= '4' {
+		if onlySpacesAndPeriods(8) {
+			return true
+		}
+	}
+
+	// Pattern 3: fall-back NTFS short name keyed by shortnamePrefix.
+	if len(shortnamePrefix) < 6 || len(name) < 8 {
+		return false
+	}
+	sawTilde := false
+	i := 0
+	for i < 8 {
+		c := name[i]
+		switch {
+		case sawTilde:
+			if c < '0' || c > '9' {
+				return false
+			}
+		case c == '~':
+			i++
+			if i >= len(name) || name[i] < '1' || name[i] > '9' {
+				return false
+			}
+			sawTilde = true
+		case i >= 6:
+			return false
+		case c&0x80 != 0:
+			return false
+		default:
+			if asciiToLower(c) != shortnamePrefix[i] {
+				return false
+			}
+		}
+		i++
+	}
+	return onlySpacesAndPeriods(8)
+}
+
+// IsNTFSDotGitmodules reports whether part is an NTFS-equivalent of
+// ".gitmodules" — the file name (or any of its variants that NTFS
+// would resolve to it) that attackers can use to plant submodule
+// configuration disguised as a symlink. The 6-character canonical
+// short-name prefix "gi7eba" mirrors upstream Git's is_ntfs_dotgitmodules.
+func IsNTFSDotGitmodules(part string) bool {
+	return IsNTFSDot(part, "gitmodules", "gi7eba")
+}
+
+func asciiToLower(c byte) byte {
+	if c >= 'A' && c <= 'Z' {
+		return c + ('a' - 'A')
+	}
+	return c
+}
@@ -0,0 +1,66 @@
+package pathutil
+
+import (
+	"fmt"
+	"path/filepath"
+	"strings"
+)
+
+// ErrInvalidPath is returned by ValidTreePath when its argument is
+// not a safe path to materialise into the worktree.
+var ErrInvalidPath = fmt.Errorf("invalid path")
+
+// ValidTreePath rejects path strings that, if materialised into a
+// worktree, would let an attacker-controlled tree entry escape the
+// worktree or rewrite repository metadata. It rejects:
+//
+//   - control characters (< 0x20, 0x7f);
+//   - empty paths and "." / ".." components;
+//   - Windows volume name prefixes (e.g. C:);
+//   - .git, its 8.3 NTFS short-name git~1, plus their HFS+ and NTFS
+//     variants — at every position, not just the root.
+//
+// HFS+/NTFS variants of `.git` are always rejected at this layer
+// regardless of runtime config: tree paths are canonical UTF-8 with
+// no zero-width characters or NTFS short-name forms, so an entry
+// that looks like a disguised `.git` is suspicious anywhere. Windows
+// reserved device names (CON, NUL, etc.) are not policed here — they
+// are legitimate filenames on non-Windows filesystems and upstream
+// Git accepts them. The wrapper layer (validPath in package git)
+// rejects them at materialisation time when core.protectNTFS is on.
+//
+// Mirrors upstream Git's verify_path_internal at read-cache.c#L987
+// in tag v2.54.0[1] with protect_hfs / protect_ntfs treated as
+// always-on for `.git`-disguise detection (tree paths are not
+// application-supplied) and is_valid_win32_path left to the wrapper.
+//
+// [1]: https://github.com/git/git/blob/v2.54.0/read-cache.c#L987
+func ValidTreePath(p string) error {
+	for i := 0; i < len(p); i++ {
+		if p[i] < 0x20 || p[i] == 0x7f {
+			return fmt.Errorf("%w %q: contains control character", ErrInvalidPath, p)
+		}
+	}
+
+	parts := strings.FieldsFunc(p, func(r rune) bool { return r == '\\' || r == '/' })
+	if len(parts) == 0 {
+		return fmt.Errorf("%w: %q", ErrInvalidPath, p)
+	}
+
+	// Volume names are not supported, in both formats: \\ and <DRIVE_LETTER>:.
+	if vol := filepath.VolumeName(p); vol != "" {
+		return fmt.Errorf("%w: %q", ErrInvalidPath, p)
+	}
+
+	for _, part := range parts {
+		if part == "." || part == ".." {
+			return fmt.Errorf("%w %q: cannot use %q", ErrInvalidPath, p, part)
+		}
+
+		if IsDotGitName(part) || IsHFSDotGit(part) || IsNTFSDotGit(part) {
+			return fmt.Errorf("%w component: %q", ErrInvalidPath, p)
+		}
+	}
+
+	return nil
+}
@@ -2,12 +2,14 @@ package url

 import (
 	"regexp"
+	"runtime"
+	"strings"
 )

 var (
 	isSchemeRegExp = regexp.MustCompile(`^[^:]+://`)

-	// Ref: https://github.com/git/git/blob/master/Documentation/urls.txt#L37
+	// Ref: https://github.com/git/git/blob/v2.54.0/Documentation/urls.adoc#L41-L48
 	scpLikeUrlRegExp = regexp.MustCompile(`^(?:(?P<user>[^@]+)@)?(?P<host>[^:\s]+):(?:(?P<port>[0-9]{1,5}):)?(?P<path>[^\\].*)$`)
 )

@@ -20,7 +22,38 @@ func MatchesScheme(url string) bool {
 // MatchesScpLike returns true if the given string matches an SCP-like
 // format scheme.
 func MatchesScpLike(url string) bool {
-	return scpLikeUrlRegExp.MatchString(url)
+	if !scpLikeUrlRegExp.MatchString(url) {
+		return false
+	}
+	// Mirror canonical Git's url_is_local_not_ssh in connect.c[1] for
+	// the cases the regex above cannot disambiguate by itself: a URL
+	// is treated as a local path (not SCP-style SSH) when a `/`
+	// precedes the first `:` (e.g. `./relative:path`,
+	// `/abs/with:colon/file`), or — on Windows only — when it has a
+	// DOS drive prefix like `C:foo` where the host is a single
+	// ASCII letter.
+	//
+	// [1]: https://github.com/git/git/blob/v2.54.0/connect.c#L710-L716
+	if before, _, _ := strings.Cut(url, ":"); strings.Contains(before, "/") {
+		return false
+	}
+	if runtime.GOOS == "windows" && hasDosDrivePrefix(url) {
+		return false
+	}
+	return true
+}
+
+// hasDosDrivePrefix reports whether s begins with `<letter>:` (a
+// Windows drive prefix such as `C:` or `c:`). Mirrors canonical Git's
+// win32_has_dos_drive_prefix[1].
+//
+// [1]: https://github.com/git/git/blob/v2.54.0/compat/win32/path-utils.c#L20-L29
+func hasDosDrivePrefix(s string) bool {
+	if len(s) < 2 || s[1] != ':' {
+		return false
+	}
+	c := s[0]
+	return ('A' <= c && c <= 'Z') || ('a' <= c && c <= 'z')
 }

 // FindScpLikeComponents returns the user, host, port and path of the
@@ -7,6 +7,7 @@ import (
 	"errors"
 	"fmt"
 	"io"
+	"io/fs"

 	"github.com/go-git/go-git/v5/plumbing/hash"
 	"github.com/go-git/go-git/v5/utils/binary"
@@ -25,35 +26,88 @@ const (
 	objectIDLength = hash.Size
 )

+// Byte sizes of the idx v2 layout elements, used by the size formula
+// in [validateIdxV2Size]. See [gitformat-pack] for the canonical
+// layout.
+//
+// [gitformat-pack]: https://git-scm.com/docs/gitformat-pack
+const (
+	headerLen     = 8          // magic + version
+	fanoutLen     = fanout * 4 // uint32 per bucket
+	crc32Len      = 4          // CRC32 per object
+	offset32Len   = 4          // 32-bit offset per object
+	offset64Len   = 8          // 64-bit overflow offset
+	trailerHashes = 2          // pack checksum + idx checksum, each hashsz
+)
+
+// statInput is the optional shape the [Decoder] probes for at the
+// start of [Decoder.Decode] to learn the on-disk length of the idx
+// blob, which it uses to validate the canonical-Git size formula
+// before any allocations driven by the fanout table. Callers that
+// pass an [*os.File] or a `billy.File` backed by an `*os.File`
+// (the production call sites in `storage/filesystem`) satisfy it
+// directly; arbitrary [io.Reader]s do not, and decode for them
+// retains the pre-existing behaviour of erroring out at the
+// truncated-payload boundary instead.
+//
+// The interface is intentionally unexported so the public
+// [NewDecoder] signature stays compatible with v5.
+type statInput interface {
+	Stat() (fs.FileInfo, error)
+}
+
 // Decoder reads and decodes idx files from an input stream.
 type Decoder struct {
 	io.Reader
-	h hash.Hash
+	src io.Reader
+	h   hash.Hash
 }

 // NewDecoder builds a new idx stream decoder, that reads from r.
 func NewDecoder(r io.Reader) *Decoder {
 	h := hash.New(crypto.SHA1)
 	tr := io.TeeReader(r, h)
-	return &Decoder{tr, h}
+	return &Decoder{tr, r, h}
 }

 // Decode reads from the stream and decode the content into the MemoryIndex struct.
 func (d *Decoder) Decode(idx *MemoryIndex) error {
+	idxSize := int64(-1)
+	if in, ok := d.src.(statInput); ok {
+		fi, err := in.Stat()
+		if err != nil {
+			return fmt.Errorf("%w: stat input: %w", ErrMalformedIdxFile, err)
+		}
+		idxSize = fi.Size()
+	}
+
 	if err := validateHeader(d); err != nil {
 		return err
 	}

-	flow := []func(*MemoryIndex, io.Reader) error{
+	headerFlow := []func(*MemoryIndex, io.Reader) error{
 		readVersion,
 		readFanout,
+	}
+	for _, f := range headerFlow {
+		if err := f(idx, d); err != nil {
+			return err
+		}
+	}
+
+	if idxSize >= 0 {
+		if err := validateIdxV2Size(idx, idxSize); err != nil {
+			return err
+		}
+	}
+
+	bodyFlow := []func(*MemoryIndex, io.Reader) error{
 		readObjectNames,
 		readCRC32,
 		readOffsets,
 		readPackChecksum,
 	}
-
-	for _, f := range flow {
+	for _, f := range bodyFlow {
 		if err := f(idx, d); err != nil {
 			return err
 		}
@@ -199,3 +253,103 @@ func readIdxChecksum(idx *MemoryIndex, r io.Reader) error {

 	return nil
 }
+
+// validateIdxV2Size enforces the size formula used by canonical Git
+// load_idx for idx v2 files: the on-disk length must lie within
+// [minSize, maxSize] where
+//
+//	perObject = hashsz + crc32Len + offset32Len
+//	minSize   = headerLen + fanoutLen + trailerHashes*hashsz + nr*perObject
+//	maxSize   = minSize + (nr-1)*offset64Len     when nr > 0
+//
+// with nr taken from the last fanout entry and hashsz fixed at
+// [objectIDLength] (SHA-1 in v5). Multiplications use a self-checking
+// overflow guard so inputs whose claimed object count overflows the
+// formula are rejected rather than wrapping into a smaller value.
+func validateIdxV2Size(idx *MemoryIndex, idxSize int64) error {
+	nr := int64(idx.Fanout[fanout-1])
+	hashsz := int64(objectIDLength)
+
+	minSize := minIdxV2Size(nr, hashsz)
+	maxSize := maxIdxV2Size(nr, hashsz)
+	if minSize < 0 || maxSize < 0 {
+		return fmt.Errorf("%w: object count %d is inconsistent with file size", ErrMalformedIdxFile, nr)
+	}
+
+	if idxSize < minSize || idxSize > maxSize {
+		return fmt.Errorf("%w: file size %d is inconsistent with object count %d", ErrMalformedIdxFile, idxSize, nr)
+	}
+	return nil
+}
+
+// minIdxV2Size returns the minimum on-disk size of an idx v2 file
+// holding nr objects with the given hash size, mirroring the
+// computation in canonical Git load_idx. Returns -1 when any
+// intermediate multiplication or addition would overflow int64.
+func minIdxV2Size(nr, hashsz int64) int64 {
+	perObject := hashsz + crc32Len + offset32Len
+	fixed := int64(headerLen+fanoutLen) + trailerHashes*hashsz
+
+	objects, ok := mulInt64(nr, perObject)
+	if !ok {
+		return -1
+	}
+	sum, ok := addInt64(fixed, objects)
+	if !ok {
+		return -1
+	}
+	return sum
+}
+
+// maxIdxV2Size returns the maximum on-disk size of an idx v2 file
+// holding nr objects with the given hash size, mirroring the
+// computation in canonical Git load_idx. Returns -1 on overflow.
+func maxIdxV2Size(nr, hashsz int64) int64 {
+	minSize := minIdxV2Size(nr, hashsz)
+	if minSize < 0 {
+		return -1
+	}
+	if nr == 0 {
+		return minSize
+	}
+	overflow, ok := mulInt64(nr-1, offset64Len)
+	if !ok {
+		return -1
+	}
+	sum, ok := addInt64(minSize, overflow)
+	if !ok {
+		return -1
+	}
+	return sum
+}
+
+// mulInt64 returns a*b and whether the result fits in an int64 without
+// overflow. Negative operands or overflow yield ok=false. The overflow
+// check uses the standard self-inverse identity: a*b/b == a only when
+// the multiplication did not wrap.
+func mulInt64(a, b int64) (int64, bool) {
+	if a < 0 || b < 0 {
+		return 0, false
+	}
+	if a == 0 || b == 0 {
+		return 0, true
+	}
+	c := a * b
+	if c/b != a {
+		return 0, false
+	}
+	return c, true
+}
+
+// addInt64 returns a+b and whether the result fits in an int64 without
+// overflow. Negative operands or overflow yield ok=false.
+func addInt64(a, b int64) (int64, bool) {
+	if a < 0 || b < 0 {
+		return 0, false
+	}
+	c := a + b
+	if c < a {
+		return 0, false
+	}
+	return c, true
+}
@@ -2,6 +2,7 @@ package idxfile

 import (
 	"bytes"
+	"fmt"
 	"io"
 	"sort"
 	"sync"
@@ -126,7 +127,10 @@ func (idx *MemoryIndex) FindOffset(h plumbing.Hash) (int64, error) {
 		return 0, plumbing.ErrObjectNotFound
 	}

-	offset := idx.getOffset(k, i)
+	offset, err := idx.getOffset(k, i)
+	if err != nil {
+		return 0, err
+	}

 	// Save the offset for reverse lookup
 	idx.mu.Lock()
@@ -141,17 +145,19 @@ func (idx *MemoryIndex) FindOffset(h plumbing.Hash) (int64, error) {

 const isO64Mask = uint64(1) << 31

-func (idx *MemoryIndex) getOffset(firstLevel, secondLevel int) uint64 {
+func (idx *MemoryIndex) getOffset(firstLevel, secondLevel int) (uint64, error) {
 	offset := secondLevel << 2
 	ofs := encbin.BigEndian.Uint32(idx.Offset32[firstLevel][offset : offset+4])

 	if (uint64(ofs) & isO64Mask) != 0 {
 		offset := 8 * (uint64(ofs) & ^isO64Mask)
-		n := encbin.BigEndian.Uint64(idx.Offset64[offset : offset+8])
-		return n
+		if l := uint64(len(idx.Offset64)); l < 8 || offset > l-8 {
+			return 0, fmt.Errorf("%w: offset64 index out of range", ErrMalformedIdxFile)
+		}
+		return encbin.BigEndian.Uint64(idx.Offset64[offset : offset+8]), nil
 	}

-	return uint64(ofs)
+	return uint64(ofs), nil
 }

 // FindCRC32 implements the Index interface.
@@ -209,8 +215,11 @@ func (idx *MemoryIndex) genOffsetHash() error {
 		mappedFirstLevel := idx.FanoutMapping[firstLevel]
 		for secondLevel := uint32(0); i < fanoutValue; i++ {
 			copy(hash[:], idx.Names[mappedFirstLevel][secondLevel*objectIDLength:])
-			offset := int64(idx.getOffset(mappedFirstLevel, int(secondLevel)))
-			offsetHash[offset] = hash
+			off, err := idx.getOffset(mappedFirstLevel, int(secondLevel))
+			if err != nil {
+				return err
+			}
+			offsetHash[int64(off)] = hash
 			secondLevel++
 		}
 	}
@@ -291,7 +300,11 @@ func (i *idxfileEntryIter) Next() (*Entry, error) {
 		mappedFirstLevel := i.idx.FanoutMapping[i.firstLevel]
 		entry := new(Entry)
 		copy(entry.Hash[:], i.idx.Names[mappedFirstLevel][i.secondLevel*objectIDLength:])
-		entry.Offset = i.idx.getOffset(mappedFirstLevel, i.secondLevel)
+		var err error
+		entry.Offset, err = i.idx.getOffset(mappedFirstLevel, i.secondLevel)
+		if err != nil {
+			return nil, err
+		}
 		entry.CRC32 = i.idx.getCRC32(mappedFirstLevel, i.secondLevel)

 		i.secondLevel++
@@ -11,9 +11,10 @@ import (
 )

 var (
-	ErrClosed       = errors.New("objfile: already closed")
-	ErrHeader       = errors.New("objfile: invalid header")
-	ErrNegativeSize = errors.New("objfile: negative object size")
+	ErrClosed        = errors.New("objfile: already closed")
+	ErrHeader        = errors.New("objfile: invalid header")
+	ErrHeaderNotRead = errors.New("objfile: Header must be called before Read")
+	ErrNegativeSize  = errors.New("objfile: negative object size")
 )

 // Reader reads and decodes compressed objfile data from a provided io.Reader.
@@ -100,12 +101,23 @@ func (r *Reader) prepareForRead(t plumbing.ObjectType, size int64) {
 //
 // If Read encounters the end of the data stream it will return err == io.EOF,
 // either in the current call if n > 0 or in a subsequent call.
+//
+// Read returns ErrHeaderNotRead if Header has not been called successfully.
 func (r *Reader) Read(p []byte) (n int, err error) {
+	if r.multi == nil {
+		return 0, ErrHeaderNotRead
+	}
 	return r.multi.Read(p)
 }

 // Hash returns the hash of the object data stream that has been read so far.
+// It returns the zero plumbing.Hash if Header has not been called
+// successfully — guarding against the nil hasher that prepareForRead has
+// not yet allocated.
 func (r *Reader) Hash() plumbing.Hash {
+	if r.multi == nil {
+		return plumbing.ZeroHash
+	}
 	return r.hasher.Sum()
 }

@@ -139,8 +139,12 @@ func (dw *deltaSelector) fixAndBreakChains(objectsToPack []*ObjectToPack) error
 		m[otp.Hash()] = otp
 	}

+	// visiting holds the objects on the current resolution path, so that a
+	// delta chain looping back on itself can be detected and broken.
+	visiting := make(map[plumbing.Hash]bool)
+
 	for _, otp := range objectsToPack {
-		if err := dw.fixAndBreakChainsOne(m, otp); err != nil {
+		if err := dw.fixAndBreakChainsOne(m, otp, visiting); err != nil {
 			return err
 		}
 	}
@@ -148,7 +152,11 @@ func (dw *deltaSelector) fixAndBreakChains(objectsToPack []*ObjectToPack) error
 	return nil
 }

-func (dw *deltaSelector) fixAndBreakChainsOne(objectsToPack map[plumbing.Hash]*ObjectToPack, otp *ObjectToPack) error {
+func (dw *deltaSelector) fixAndBreakChainsOne(
+	objectsToPack map[plumbing.Hash]*ObjectToPack,
+	otp *ObjectToPack,
+	visiting map[plumbing.Hash]bool,
+) error {
 	if !otp.Object.Type().IsDelta() {
 		return nil
 	}
@@ -174,7 +182,21 @@ func (dw *deltaSelector) fixAndBreakChainsOne(objectsToPack map[plumbing.Hash]*O
 		return dw.undeltify(otp)
 	}

-	if err := dw.fixAndBreakChainsOne(objectsToPack, base); err != nil {
+	// Mark this object as being resolved before looking at its base, so that
+	// a delta based on itself is caught by the check below.
+	h := otp.Hash()
+	visiting[h] = true
+	defer delete(visiting, h)
+
+	// A delta chain that loops back onto an object we are already resolving
+	// cannot be written: every delta needs its base written first. Break the
+	// chain here instead of following the cycle, which would recurse until
+	// the goroutine stack is exhausted.
+	if visiting[do.BaseHash()] {
+		return dw.undeltify(otp)
+	}
+
+	if err := dw.fixAndBreakChainsOne(objectsToPack, base, visiting); err != nil {
 		return err
 	}

@@ -19,9 +19,6 @@ const (
 	// https://github.com/git/git/blob/f7466e94375b3be27f229c78873f0acf8301c0a5/diff-delta.c#L428
 	// Max size of a copy operation (64KB).
 	maxCopySize = 64 * 1024
-
-	// Min size of a copy operation.
-	minCopySize = 4
 )

 // GetDelta returns an EncodedObject of type OFSDeltaObject. Base and Target object,
@@ -78,7 +78,13 @@ func (o *FSObject) Reader() (io.ReadCloser, error) {
 			_ = f.Close()
 			return nil, err
 		}
-		return ioutil.NewReadCloserWithCloser(r, f.Close), nil
+		// Cap the lazy stream at the resolved object size: well-formed
+		// content reaches EOF inside the bound, an inflated stream that
+		// runs past surfaces ErrInflatedSizeMismatch on the byte just
+		// past the limit. For delta-resolved objects o.size is the
+		// expanded size, which is what the caller is reading here.
+		bounded := newBoundedReadCloser(r, o.size)
+		return ioutil.NewReadCloserWithCloser(bounded, f.Close), nil
 	}
 	r, err := p.getObjectContent(o.offset)
 	if err != nil {
@@ -126,11 +126,17 @@ func (p *Packfile) nextObjectHeader() (*ObjectHeader, error) {
 	return h, err
 }

-func (p *Packfile) getDeltaObjectSize(buf *bytes.Buffer) int64 {
+func (p *Packfile) getDeltaObjectSize(buf *bytes.Buffer) (int64, error) {
 	delta := buf.Bytes()
-	_, delta = decodeLEB128(delta) // skip src size
-	sz, _ := decodeLEB128(delta)
-	return int64(sz)
+	_, delta, err := decodeLEB128(delta) // skip src size
+	if err != nil {
+		return 0, err
+	}
+	sz, _, err := decodeLEB128(delta)
+	if err != nil {
+		return 0, err
+	}
+	return int64(sz), nil
 }

 func (p *Packfile) getObjectSize(h *ObjectHeader) (int64, error) {
@@ -145,7 +151,7 @@ func (p *Packfile) getObjectSize(h *ObjectHeader) (int64, error) {
 			return 0, err
 		}

-		return p.getDeltaObjectSize(buf), nil
+		return p.getDeltaObjectSize(buf)
 	default:
 		return 0, ErrInvalidObject.AddDetails("type %q", h.Type)
 	}
@@ -233,7 +239,10 @@ func (p *Packfile) getNextObject(h *ObjectHeader, hash plumbing.Hash) (plumbing.
 			return nil, err
 		}

-		size = p.getDeltaObjectSize(buf)
+		size, err = p.getDeltaObjectSize(buf)
+		if err != nil {
+			return nil, err
+		}
 		if size <= smallObjectThreshold {
 			var obj = new(plumbing.MemoryObject)
 			obj.SetSize(size)
@@ -26,6 +26,45 @@ var (
 	ErrDeltaNotCached = errors.New("delta could not be found in cache")
 )

+// maxObjectPreallocBytes caps the up-front size hint passed to
+// bytes.Buffer.Grow when staging an object's contents, so a malformed length
+// cannot trigger a huge or out-of-range allocation. The buffer still grows
+// dynamically as data is written; this is purely a hint cap.
+const maxObjectPreallocBytes = 1 << 30 // 1 GiB
+
+// maxObjectsPrealloc caps the up-front capacity reserved from the pack's
+// declared object count, so a header advertising an absurd quantity cannot
+// trigger a multi-gigabyte allocation. The slice and maps still grow
+// organically beyond this hint.
+const maxObjectsPrealloc = 1 << 16 // 64 Ki entries
+
+// Match upstream Git's pack depth ceiling: pack-objects.h OE_DEPTH_BITS,
+// enforced in builtin/pack-objects.c as (1 << OE_DEPTH_BITS) - 1.
+const maxDeltaChainDepth = 4095
+
+// growHint returns a non-negative int64 size, clamped to a sane upper bound,
+// suitable for passing to bytes.Buffer.Grow.
+func growHint(n int64) int {
+	switch {
+	case n <= 0:
+		return 0
+	case n > maxObjectPreallocBytes:
+		return maxObjectPreallocBytes
+	default:
+		return int(n)
+	}
+}
+
+// objectsHint returns a non-negative count, clamped to maxObjectsPrealloc,
+// suitable for passing to make() as the capacity hint for slices or maps
+// sized from a pack's declared object count.
+func objectsHint(n uint32) int {
+	if n > maxObjectsPrealloc {
+		return maxObjectsPrealloc
+	}
+	return int(n)
+}
+
 // Observer interface is implemented by index encoders.
 type Observer interface {
 	// OnHeader is called when a new packfile is opened.
@@ -166,9 +205,10 @@ func (p *Parser) init() error {
 	}

 	p.count = c
-	p.oiByHash = make(map[plumbing.Hash]*objectInfo, p.count)
-	p.oiByOffset = make(map[int64]*objectInfo, p.count)
-	p.oi = make([]*objectInfo, p.count)
+	hint := objectsHint(p.count)
+	p.oiByHash = make(map[plumbing.Hash]*objectInfo, hint)
+	p.oiByOffset = make(map[int64]*objectInfo, hint)
+	p.oi = make([]*objectInfo, 0, hint)

 	return nil
 }
@@ -261,7 +301,7 @@ func (p *Parser) indexObjects() error {
 		}
 		if delta && !p.scanner.IsSeekable {
 			buf.Reset()
-			buf.Grow(int(oh.Length))
+			buf.Grow(growHint(oh.Length))
 			writers = append(writers, buf)
 		}

@@ -306,7 +346,7 @@ func (p *Parser) indexObjects() error {
 		}

 		p.oiByOffset[oh.Offset] = ota
-		p.oi[i] = ota
+		p.oi = append(p.oi, ota)
 	}

 	return nil
@@ -317,8 +357,12 @@ func (p *Parser) resolveDeltas() error {
 	defer sync.PutBytesBuffer(buf)

 	for _, obj := range p.oi {
+		if err := checkDeltaChainDepth(obj); err != nil {
+			return err
+		}
+
 		buf.Reset()
-		buf.Grow(int(obj.Length))
+		buf.Grow(growHint(obj.Length))
 		err := p.get(obj, buf)
 		if err != nil {
 			return err
@@ -337,6 +381,9 @@ func (p *Parser) resolveDeltas() error {
 			// create it once and reuse across all children.
 			r := bytes.NewReader(buf.Bytes())
 			for _, child := range obj.Children {
+				if err := checkDeltaChainDepth(child); err != nil {
+					return err
+				}
 				// Even though we are discarding the output, we still need to read it to
 				// so that the scanner can advance to the next object, and the SHA1 can be
 				// calculated.
@@ -356,6 +403,17 @@ func (p *Parser) resolveDeltas() error {
 	return nil
 }

+func checkDeltaChainDepth(o *objectInfo) error {
+	var depth int
+	for current := o; current != nil && current.DiskType.IsDelta(); current = current.Parent {
+		depth++
+		if depth > maxDeltaChainDepth {
+			return fmt.Errorf("%w: delta chain depth exceeds %d", ErrMalformedPackFile, maxDeltaChainDepth)
+		}
+	}
+	return nil
+}
+
 func (p *Parser) resolveExternalRef(o *objectInfo) {
 	if ref, ok := p.oiByHash[o.SHA1]; ok && ref.ExternalRef {
 		p.oiByHash[o.SHA1] = o
@@ -405,7 +463,7 @@ func (p *Parser) get(o *objectInfo, buf *bytes.Buffer) (err error) {
 	if o.DiskType.IsDelta() {
 		b := sync.GetBytesBuffer()
 		defer sync.PutBytesBuffer(b)
-		buf.Grow(int(o.Length))
+		buf.Grow(growHint(o.Length))
 		err := p.get(o.Parent, b)
 		if err != nil {
 			return err
@@ -31,10 +31,15 @@ const (
 	// premptively made available for a patch operation.
 	maxPatchPreemptionSize uint = 65536

-	// minDeltaSize defines the smallest size for a delta.
-	minDeltaSize = 4
+	// minDeltaSize is the smallest valid delta: a 1-byte srcSz LEB128
+	// header followed by a 1-byte targetSz LEB128 header (the
+	// shortest case being targetSz=0 with no operations).
+	minDeltaSize = 2
 )

+// uintBits is the bit width of uint on the current platform (32 or 64).
+const uintBits = 32 << (^uint(0) >> 63)
+
 type offset struct {
 	mask  byte
 	shift uint
@@ -142,7 +147,7 @@ func ReaderFromDelta(base plumbing.EncodedObject, deltaRC io.Reader) (io.ReadClo
 		baseBuf := bufio.NewReader(baseRd)
 		basePos := uint(0)

-		for {
+		for remainingTargetSz > 0 {
 			cmd, err := deltaBuf.ReadByte()
 			if err == io.EOF {
 				_ = dstWr.CloseWithError(ErrInvalidDelta)
@@ -166,9 +171,9 @@ func ReaderFromDelta(base plumbing.EncodedObject, deltaRC io.Reader) (io.ReadClo
 					return
 				}

-				if invalidSize(sz, targetSz) ||
+				if invalidSize(sz, remainingTargetSz) ||
 					invalidOffsetSize(offset, sz, srcSz) {
-					_ = dstWr.Close()
+					_ = dstWr.CloseWithError(ErrInvalidDelta)
 					return
 				}

@@ -210,7 +215,7 @@ func ReaderFromDelta(base plumbing.EncodedObject, deltaRC io.Reader) (io.ReadClo

 			case isCopyFromDelta(cmd):
 				sz := uint(cmd) // cmd is the size itself
-				if invalidSize(sz, targetSz) {
+				if invalidSize(sz, remainingTargetSz) {
 					_ = dstWr.CloseWithError(ErrInvalidDelta)
 					return
 				}
@@ -225,40 +230,48 @@ func ReaderFromDelta(base plumbing.EncodedObject, deltaRC io.Reader) (io.ReadClo
 				_ = dstWr.CloseWithError(ErrDeltaCmd)
 				return
 			}
-
-			if remainingTargetSz <= 0 {
-				_ = dstWr.Close()
-				return
-			}
 		}
+
+		// Mirror upstream's `data != top` post-loop check: every byte
+		// of the delta payload must be consumed.
+		if _, err := deltaBuf.ReadByte(); err == nil {
+			_ = dstWr.CloseWithError(ErrInvalidDelta)
+			return
+		} else if err != io.EOF {
+			_ = dstWr.CloseWithError(err)
+			return
+		}
+
+		_ = dstWr.Close()
 	}()

 	return dstRd, nil
 }

 func patchDelta(dst *bytes.Buffer, src, delta []byte) error {
-	if len(delta) < minCopySize {
-		return ErrInvalidDelta
+	srcSz, delta, err := decodeLEB128(delta)
+	if err != nil {
+		return fmt.Errorf("%w: %w", ErrInvalidDelta, err)
 	}
-
-	srcSz, delta := decodeLEB128(delta)
 	if srcSz != uint(len(src)) {
 		return ErrInvalidDelta
 	}

-	targetSz, delta := decodeLEB128(delta)
+	targetSz, delta, err := decodeLEB128(delta)
+	if err != nil {
+		return fmt.Errorf("%w: %w", ErrInvalidDelta, err)
+	}
 	remainingTargetSz := targetSz

-	var cmd byte
-
 	growSz := min(targetSz, maxPatchPreemptionSize)
 	dst.Grow(int(growSz))
-	for {
+
+	for remainingTargetSz > 0 {
 		if len(delta) == 0 {
 			return ErrInvalidDelta
 		}

-		cmd = delta[0]
+		cmd := delta[0]
 		delta = delta[1:]

 		switch {
@@ -275,16 +288,16 @@ func patchDelta(dst *bytes.Buffer, src, delta []byte) error {
 				return err
 			}

-			if invalidSize(sz, targetSz) ||
+			if invalidSize(sz, remainingTargetSz) ||
 				invalidOffsetSize(offset, sz, srcSz) {
-				break
+				return ErrInvalidDelta
 			}
 			dst.Write(src[offset : offset+sz])
 			remainingTargetSz -= sz

 		case isCopyFromDelta(cmd):
 			sz := uint(cmd) // cmd is the size itself
-			if invalidSize(sz, targetSz) {
+			if invalidSize(sz, remainingTargetSz) {
 				return ErrInvalidDelta
 			}

@@ -299,10 +312,12 @@ func patchDelta(dst *bytes.Buffer, src, delta []byte) error {
 		default:
 			return ErrDeltaCmd
 		}
+	}

-		if remainingTargetSz <= 0 {
-			break
-		}
+	// Mirror upstream's `data != top` post-loop check: every byte of
+	// the delta payload must be consumed.
+	if len(delta) != 0 {
+		return ErrInvalidDelta
 	}

 	return nil
@@ -354,7 +369,7 @@ func patchDeltaWriter(dst io.Writer, base io.ReaderAt, delta io.Reader,
 	baselr := io.LimitReader(sr, 0).(*io.LimitedReader)
 	deltalr := io.LimitReader(deltaBuf, 0).(*io.LimitedReader)

-	for {
+	for remainingTargetSz > 0 {
 		buf := *bufp
 		cmd, err := deltaBuf.ReadByte()
 		if err == io.EOF {
@@ -374,9 +389,9 @@ func patchDeltaWriter(dst io.Writer, base io.ReaderAt, delta io.Reader,
 				return 0, plumbing.ZeroHash, err
 			}

-			if invalidSize(sz, targetSz) ||
+			if invalidSize(sz, remainingTargetSz) ||
 				invalidOffsetSize(offset, sz, srcSz) {
-				return 0, plumbing.ZeroHash, err
+				return 0, plumbing.ZeroHash, ErrInvalidDelta
 			}

 			if _, err := sr.Seek(int64(offset), io.SeekStart); err != nil {
@@ -389,7 +404,7 @@ func patchDeltaWriter(dst io.Writer, base io.ReaderAt, delta io.Reader,
 			remainingTargetSz -= sz
 		} else if isCopyFromDelta(cmd) {
 			sz := uint(cmd) // cmd is the size itself
-			if invalidSize(sz, targetSz) {
+			if invalidSize(sz, remainingTargetSz) {
 				return 0, plumbing.ZeroHash, ErrInvalidDelta
 			}
 			deltalr.N = int64(sz)
@@ -399,30 +414,41 @@ func patchDeltaWriter(dst io.Writer, base io.ReaderAt, delta io.Reader,

 			remainingTargetSz -= sz
 		} else {
-			return 0, plumbing.ZeroHash, err
-		}
-		if remainingTargetSz <= 0 {
-			break
+			return 0, plumbing.ZeroHash, ErrDeltaCmd
 		}
 	}

+	// Mirror upstream's `data != top` post-loop check: every byte of
+	// the delta payload must be consumed.
+	if _, err := deltaBuf.ReadByte(); err == nil {
+		return 0, plumbing.ZeroHash, ErrInvalidDelta
+	} else if err != io.EOF {
+		return 0, plumbing.ZeroHash, err
+	}
+
 	return targetSz, hasher.Sum(), nil
 }

 // Decodes a number encoded as an unsigned LEB128 at the start of some
-// binary data and returns the decoded number and the rest of the
-// stream.
+// binary data and returns the decoded number, the rest of the stream,
+// and an error if the encoded value does not fit in a uint.
 //
 // This must be called twice on the delta data buffer, first to get the
 // expected source buffer size, and again to get the target buffer size.
-func decodeLEB128(input []byte) (uint, []byte) {
+func decodeLEB128(input []byte) (uint, []byte, error) {
 	if len(input) == 0 {
-		return 0, input
+		return 0, input, nil
 	}

 	var num, sz uint
 	var b byte
 	for {
+		// A continuation byte at shift > uintBits-7 cannot contribute
+		// without overflowing the accumulator.
+		if sz*7 > uintBits-7 {
+			return 0, input, ErrLengthOverflow
+		}
+
 		b = input[sz]
 		num |= (uint(b) & payload) << (sz * 7) // concats 7 bits chunks
 		sz++
@@ -432,12 +458,16 @@ func decodeLEB128(input []byte) (uint, []byte) {
 		}
 	}

-	return num, input[sz:]
+	return num, input[sz:], nil
 }

 func decodeLEB128ByteReader(input io.ByteReader) (uint, error) {
 	var num, sz uint
 	for {
+		if sz*7 > uintBits-7 {
+			return 0, ErrLengthOverflow
+		}
+
 		b, err := input.ReadByte()
 		if err != nil {
 			return 0, err
@@ -529,8 +559,9 @@ func decodeSize(cmd byte, delta []byte) (uint, []byte, error) {
 	return sz, delta, nil
 }

-func invalidSize(sz, targetSz uint) bool {
-	return sz > targetSz
+// invalidSize reports whether sz exceeds the remaining target size.
+func invalidSize(sz, remaining uint) bool {
+	return sz > remaining
 }

 func invalidOffsetSize(offset, sz, srcSz uint) bool {
@@ -29,8 +29,100 @@ var (
 	ErrSeekNotSupported = NewError("not seek support")
 	// ErrMalformedPackFile is returned by the parser when the pack file is corrupted.
 	ErrMalformedPackFile = errors.New("malformed PACK file")
+	// ErrLengthOverflow is returned when a variable-length integer would not
+	// fit into its accumulator because the input declares more continuation
+	// bytes than the type can hold.
+	ErrLengthOverflow = errors.New("variable-length integer overflow")
+	// ErrInflatedSizeMismatch is returned when a packfile object inflates to
+	// more bytes than the size declared in its object header. A well-formed
+	// packfile never produces more data than the declared size; exceeding it
+	// indicates a structurally invalid entry.
+	ErrInflatedSizeMismatch = errors.New("packfile: inflated object exceeds declared size")
 )

+// boundedWriter passes writes through to w up to limit bytes total, then
+// returns ErrInflatedSizeMismatch. It is used to enforce that a packfile
+// object's inflated length does not exceed the size declared in its header.
+type boundedWriter struct {
+	w     io.Writer
+	limit int64
+	n     int64
+}
+
+// Write forwards p to the underlying writer while keeping the running total
+// at or below limit. On overrun it forwards the legal prefix and reports
+// the number of bytes actually consumed alongside ErrInflatedSizeMismatch,
+// matching the contract in io.Writer. A write error from the underlying
+// writer during overrun-handling is joined with ErrInflatedSizeMismatch so
+// it is not silently dropped.
+func (b *boundedWriter) Write(p []byte) (int, error) {
+	if b.n+int64(len(p)) > b.limit {
+		remain := int(b.limit - b.n)
+		err := error(ErrInflatedSizeMismatch)
+		if remain > 0 {
+			n, werr := b.w.Write(p[:remain])
+			b.n += int64(n)
+			if werr != nil {
+				err = errors.Join(ErrInflatedSizeMismatch, werr)
+			}
+			return n, err
+		}
+		return 0, err
+	}
+	n, err := b.w.Write(p)
+	b.n += int64(n)
+	return n, err
+}
+
+// boundedReadCloser wraps a ReadCloser and reports ErrInflatedSizeMismatch
+// once more than limit bytes have been read. It is used by the on-demand
+// object reader returned from FSObject.Reader so that a lazy Read of a
+// packfile object cannot stream past its declared inflated size.
+//
+// The implementation builds on io.LimitedReader with the standard
+// overrun-detection trick: request limit+1 bytes from the underlying so
+// that the moment the sentinel byte materializes (LimitedReader.N drops
+// to zero) we know the source produced more than limit bytes.
+type boundedReadCloser struct {
+	lr      io.LimitedReader
+	closer  io.Closer
+	overrun bool
+}
+
+// newBoundedReadCloser wraps rc so that the cumulative bytes returned from
+// Read never exceed limit. The first call that would have returned a byte
+// past limit instead returns ErrInflatedSizeMismatch; subsequent calls
+// keep returning the same error. A negative limit is treated as zero, so
+// the first byte produced by rc surfaces ErrInflatedSizeMismatch.
+func newBoundedReadCloser(rc io.ReadCloser, limit int64) *boundedReadCloser {
+	if limit < 0 {
+		limit = 0
+	}
+	return &boundedReadCloser{
+		lr:     io.LimitedReader{R: rc, N: limit + 1},
+		closer: rc,
+	}
+}
+
+// Read forwards Read up to the configured byte limit. When the underlying
+// stream produces the limit+1 sentinel byte, the legal prefix is returned
+// alongside ErrInflatedSizeMismatch; on subsequent calls only the error
+// is returned.
+func (b *boundedReadCloser) Read(p []byte) (int, error) {
+	if b.overrun {
+		return 0, ErrInflatedSizeMismatch
+	}
+	n, err := b.lr.Read(p)
+	if b.lr.N == 0 {
+		b.overrun = true
+		return n - 1, ErrInflatedSizeMismatch
+	}
+	return n, err
+}
+
+// Close closes the underlying ReadCloser.
+func (b *boundedReadCloser) Close() error { return b.closer.Close() }
+
 // ObjectHeader contains the information related to the object, this information
 // is collected from the previous bytes to the content of the object.
 type ObjectHeader struct {
@@ -220,6 +312,13 @@ func (s *Scanner) nextObjectHeader() (*ObjectHeader, error) {
 			return nil, err
 		}

+		// An OFS-delta references a base object that appears earlier
+		// in the pack; the negative offset must be strictly positive
+		// and not larger than the current object's offset.
+		if no <= 0 || no > h.Offset {
+			return nil, fmt.Errorf("%w: invalid OFS delta offset", ErrMalformedPackFile)
+		}
+
 		h.OffsetReference = h.Offset - no
 	case plumbing.REFDeltaObject:
 		var err error
@@ -303,6 +402,13 @@ func (s *Scanner) readLength(first byte) (int64, error) {
 	shift := firstLengthBits
 	var err error
 	for c&maskContinue > 0 {
+		// Mirrors unpack_object_header_buffer in canonical Git's
+		// packfile.c: a continuation byte at shift > 64-7 cannot
+		// contribute without overflowing an int64.
+		if shift > 64-lengthBits {
+			return 0, fmt.Errorf("%w: %w", ErrMalformedPackFile, ErrLengthOverflow)
+		}
+
 		if c, err = s.r.ReadByte(); err != nil {
 			return 0, err
 		}
@@ -315,10 +421,18 @@ func (s *Scanner) readLength(first byte) (int64, error) {
 }

 // NextObject writes the content of the next object into the reader, returns
-// the number of bytes written, the CRC32 of the content and an error, if any
+// the number of bytes written, the CRC32 of the content and an error, if any.
+//
+// When a prior NextObjectHeader has stashed the object header in
+// pendingObject, the inflated stream is bounded by the header's declared
+// length and surfaces ErrInflatedSizeMismatch on overrun.
 func (s *Scanner) NextObject(w io.Writer) (written int64, crc32 uint32, err error) {
+	declaredSize := int64(-1)
+	if s.pendingObject != nil {
+		declaredSize = s.pendingObject.Length
+	}
 	s.pendingObject = nil
-	written, err = s.copyObject(w)
+	written, err = s.copyObject(w, declaredSize)

 	s.r.Flush()
 	crc32 = s.crc.Sum32()
@@ -327,23 +441,39 @@ func (s *Scanner) NextObject(w io.Writer) (written int64, crc32 uint32, err erro
 	return
 }

-// ReadObject returns a reader for the object content and an error
+// ReadObject returns a reader for the object content and an error.
+//
+// When a prior NextObjectHeader has stashed the object header in
+// pendingObject, the returned reader is bounded by the header's declared
+// length so callers cannot stream past the declared inflated size; an
+// overrun surfaces ErrInflatedSizeMismatch on the byte just past the
+// limit.
 func (s *Scanner) ReadObject() (io.ReadCloser, error) {
+	declaredSize := int64(-1)
+	if s.pendingObject != nil {
+		declaredSize = s.pendingObject.Length
+	}
 	s.pendingObject = nil
 	zr, err := sync.GetZlibReader(s.r)
 	if err != nil {
 		return nil, fmt.Errorf("zlib reset error: %s", err)
 	}

-	return ioutil.NewReadCloserWithCloser(zr.Reader, func() error {
+	rc := ioutil.NewReadCloserWithCloser(zr.Reader, func() error {
 		sync.PutZlibReader(zr)
 		return nil
-	}), nil
+	})
+	if declaredSize >= 0 {
+		return newBoundedReadCloser(rc, declaredSize), nil
+	}
+	return rc, nil
 }

-// ReadRegularObject reads and write a non-deltified object
-// from it zlib stream in an object entry in the packfile.
-func (s *Scanner) copyObject(w io.Writer) (n int64, err error) {
+// copyObject inflates a non-deltified object's zlib stream into w. When
+// declaredSize is non-negative, the write sink is wrapped in a
+// boundedWriter so an overrun surfaces ErrInflatedSizeMismatch instead
+// of being silently appended.
+func (s *Scanner) copyObject(w io.Writer, declaredSize int64) (n int64, err error) {
 	zr, err := sync.GetZlibReader(s.r)
 	defer sync.PutZlibReader(zr)

@@ -352,8 +482,14 @@ func (s *Scanner) copyObject(w io.Writer) (n int64, err error) {
 	}

 	defer ioutil.CheckClose(zr.Reader, &err)
+
+	sink := w
+	if declaredSize >= 0 {
+		sink = &boundedWriter{w: w, limit: declaredSize}
+	}
+
 	buf := sync.GetByteSlice()
-	n, err = io.CopyBuffer(w, zr.Reader, *buf)
+	n, err = io.CopyBuffer(sink, zr.Reader, *buf)
 	sync.PutByteSlice(buf)
 	return
 }
@@ -5,7 +5,7 @@ import (
 	"context"
 	"errors"
 	"fmt"
-	"io"
+	"slices"
 	"strings"

 	"github.com/ProtonMail/go-crypto/openpgp"
@@ -20,6 +20,7 @@ const (
 	beginpgp       string = "-----BEGIN PGP SIGNATURE-----"
 	endpgp         string = "-----END PGP SIGNATURE-----"
 	headerpgp      string = "gpgsig"
+	headerpgp256   string = "gpgsig-sha256"
 	headerencoding string = "encoding"

 	// https://github.com/git/git/blob/bcb6cae2966cc407ca1afc77413b3ef11103c175/Documentation/gitformat-signature.txt#L153
@@ -41,6 +42,11 @@ type MessageEncoding string
 // in time, such as a timestamp, the author of the changes since the last
 // commit, a pointer to the previous commit(s), etc.
 // http://shafiulazam.com/gitbook/1_the_git_object_model.html
+//
+// When a Commit is populated by Decode it retains a reference to the source
+// plumbing.EncodedObject so that EncodeWithoutSignature can reproduce the
+// exact bytes the signature was computed over. Refer to EncodeWithoutSignature
+// for more information.
 type Commit struct {
 	// Hash of the commit object.
 	Hash plumbing.Hash
@@ -66,6 +72,9 @@ type Commit struct {
 	ExtraHeaders []ExtraHeader

 	s storer.EncodedObjectStorer
+	// src holds the encoded object this Commit was decoded from, used by
+	// EncodeWithoutSignature to recover the canonical signed bytes.
+	src plumbing.EncodedObject
 }

 // ExtraHeader holds any non-standard header
@@ -98,8 +107,8 @@ func (h ExtraHeader) Format(f fmt.State, verb rune) {
 func parseExtraHeader(line []byte) (ExtraHeader, bool) {
 	split := bytes.SplitN(line, []byte{' '}, 2)

-	out := ExtraHeader {
-		Key: string(bytes.TrimRight(split[0], "\n")),
+	out := ExtraHeader{
+		Key:   string(bytes.TrimRight(split[0], "\n")),
 		Value: "",
 	}

@@ -181,6 +190,11 @@ func (c *Commit) NumParents() int {

 var ErrParentNotFound = errors.New("commit parent not found")

+// ErrMalformedCommit is returned when a commit object cannot be decoded
+// because its standard headers (tree, parent, author, committer) are missing,
+// duplicated, or out of order.
+var ErrMalformedCommit = errors.New("malformed commit")
+
 // Parent returns the ith parent of a commit.
 func (c *Commit) Parent(i int) (*Commit, error) {
 	if len(c.ParentHashes) == 0 || i > len(c.ParentHashes)-1 {
@@ -227,14 +241,23 @@ func (c *Commit) Type() plumbing.ObjectType {
 	return plumbing.CommitObject
 }

+func (c *Commit) reset() {
+	storer := c.s
+	*c = Commit{
+		Encoding: defaultUtf8CommitMessageEncoding,
+		s:        storer,
+	}
+}
+
 // Decode transforms a plumbing.EncodedObject into a Commit struct.
 func (c *Commit) Decode(o plumbing.EncodedObject) (err error) {
 	if o.Type() != plumbing.CommitObject {
 		return ErrUnsupportedObject
 	}

+	c.reset()
 	c.Hash = o.Hash()
-	c.Encoding = defaultUtf8CommitMessageEncoding
+	c.src = o

 	reader, err := o.Reader()
 	if err != nil {
@@ -245,97 +268,17 @@ func (c *Commit) Decode(o plumbing.EncodedObject) (err error) {
 	r := sync.GetBufioReader(reader)
 	defer sync.PutBufioReader(r)

-	var message bool
-	var mergetag bool
-	var pgpsig bool
-	var msgbuf bytes.Buffer
-	var extraheader *ExtraHeader = nil
-	for {
-		line, err := r.ReadBytes('\n')
-		if err != nil && err != io.EOF {
+	s := &commitScanner{r: r, c: c}
+	for state := scanTree; state != nil; {
+		state, err = state(s)
+		if err != nil {
 			return err
 		}
-
-		if mergetag {
-			if len(line) > 0 && line[0] == ' ' {
-				line = bytes.TrimLeft(line, " ")
-				c.MergeTag += string(line)
-				continue
-			} else {
-				mergetag = false
-			}
-		}
-
-		if pgpsig {
-			if len(line) > 0 && line[0] == ' ' {
-				line = bytes.TrimLeft(line, " ")
-				c.PGPSignature += string(line)
-				continue
-			} else {
-				pgpsig = false
-			}
-		}
-
-		if extraheader != nil {
-			if len(line) > 0 && line[0] == ' ' {
-				extraheader.Value += string(line[1:])
-				continue
-			} else {
-				extraheader.Value = strings.TrimRight(extraheader.Value, "\n")
-				c.ExtraHeaders = append(c.ExtraHeaders, *extraheader)
-				extraheader = nil
-			}
-		}
-
-		if !message {
-			original_line := line
-			line = bytes.TrimSpace(line)
-			if len(line) == 0 {
-				message = true
-				continue
-			}
-
-			split := bytes.SplitN(line, []byte{' '}, 2)
-
-			var data []byte
-			if len(split) == 2 {
-				data = split[1]
-			}
-
-			switch string(split[0]) {
-			case "tree":
-				c.TreeHash = plumbing.NewHash(string(data))
-			case "parent":
-				c.ParentHashes = append(c.ParentHashes, plumbing.NewHash(string(data)))
-			case "author":
-				c.Author.Decode(data)
-			case "committer":
-				c.Committer.Decode(data)
-			case headermergetag:
-				c.MergeTag += string(data) + "\n"
-				mergetag = true
-			case headerencoding:
-				c.Encoding = MessageEncoding(data)
-			case headerpgp:
-				c.PGPSignature += string(data) + "\n"
-				pgpsig = true
-			default:
-				h, maybecontinued := parseExtraHeader(original_line)
-				if maybecontinued {
-					extraheader = &h
-				} else {
-					c.ExtraHeaders = append(c.ExtraHeaders, h)
-				}
-			}
-		} else {
-			msgbuf.Write(line)
-		}
-
-		if err == io.EOF {
-			break
-		}
 	}
-	c.Message = msgbuf.String()
+	if !s.sawTree {
+		return fmt.Errorf("%w: missing tree header", ErrMalformedCommit)
+	}
+	c.Message = s.msgbuf.String()
 	return nil
 }

@@ -344,11 +287,73 @@ func (c *Commit) Encode(o plumbing.EncodedObject) error {
 	return c.encode(o, true)
 }

-// EncodeWithoutSignature export a Commit into a plumbing.EncodedObject without the signature (correspond to the payload of the PGP signature).
+// EncodeWithoutSignature exports a Commit into a plumbing.EncodedObject
+// without any signature headers, producing the payload that PGP/GPG
+// signatures are computed over.
+//
+// Behaviour depends on how the Commit was created:
+//
+//   - For Commits populated by Decode whose exported fields still match the
+//     source object, the payload is streamed from the raw source bytes with
+//     gpgsig and gpgsig-sha256 headers (and their continuation lines)
+//     stripped verbatim. This preserves the exact bytes the signature was
+//     computed over, regardless of any normalization performed by Decode.
+//
+//   - For Commits constructed in memory, or for decoded Commits whose
+//     exported fields have been mutated, the payload is derived from the
+//     current struct fields. Mutation is detected by re-decoding the source
+//     object and comparing exported fields; if any differ, the in-memory
+//     representation prevails.
 func (c *Commit) EncodeWithoutSignature(o plumbing.EncodedObject) error {
+	if c.matchesSource() {
+		return stripObjectSignatures(o, c.src, plumbing.CommitObject)
+	}
 	return c.encode(o, false)
 }

+// matchesSource reports whether c.src is set and re-decoding it produces a
+// Commit whose payload-affecting exported fields are identical to those of
+// c. It is the auto-detection used by EncodeWithoutSignature to decide
+// between the raw bytes and the struct-encoded payload.
+//
+// PGPSignature is intentionally excluded from the comparison: neither path
+// emits it, so mutating it must not trigger a switch to struct-encode (which
+// would change the byte layout the caller is trying to verify against).
+func (c *Commit) matchesSource() bool {
+	if c.src == nil {
+		return false
+	}
+	fresh := &Commit{}
+	if err := fresh.Decode(c.src); err != nil {
+		return false
+	}
+	return c.Hash == fresh.Hash &&
+		signatureEqual(c.Author, fresh.Author) &&
+		signatureEqual(c.Committer, fresh.Committer) &&
+		c.MergeTag == fresh.MergeTag &&
+		c.Message == fresh.Message &&
+		c.TreeHash == fresh.TreeHash &&
+		c.Encoding == fresh.Encoding &&
+		slices.Equal(c.ParentHashes, fresh.ParentHashes) &&
+		slices.Equal(c.ExtraHeaders, fresh.ExtraHeaders)
+}
+
+func signatureEqual(a, b Signature) bool {
+	return a.Name == b.Name &&
+		a.Email == b.Email &&
+		a.When.Unix() == b.When.Unix() &&
+		a.When.Format("-0700") == b.When.Format("-0700")
+}
+
+func isStandardHeader(key string) bool {
+	switch key {
+	case "tree", "parent", "author", "committer",
+		headerencoding, headermergetag, headerpgp, headerpgp256:
+		return true
+	}
+	return false
+}
+
 func (c *Commit) encode(o plumbing.EncodedObject, includeSig bool) (err error) {
 	o.SetType(plumbing.CommitObject)
 	w, err := o.Writer()
@@ -407,7 +412,9 @@ func (c *Commit) encode(o plumbing.EncodedObject, includeSig bool) (err error) {
 	}

 	for _, header := range c.ExtraHeaders {
-		
+		if isStandardHeader(header.Key) {
+			continue
+		}
 		if _, err = fmt.Fprintf(w, "\n%s", header); err != nil {
 			return err
 		}
@@ -478,9 +485,21 @@ func (c *Commit) String() string {
 	)
 }

+// ErrMultipleSignatures is returned by Verify when the commit carries more
+// than one armored signature block. Mirrors upstream's parse_gpg_output
+// rejection of GOODSIG/BADSIG status lines after the first
+// (gpg-interface.c:257-269): multi-signature commits are intentionally
+// unsupported because their provenance cannot be reduced to a single
+// authoritative signer.
+var ErrMultipleSignatures = errors.New("commit has multiple signatures")
+
 // Verify performs PGP verification of the commit with a provided armored
 // keyring and returns openpgp.Entity associated with verifying key on success.
 func (c *Commit) Verify(armoredKeyRing string) (*openpgp.Entity, error) {
+	if countSignatureBlocks([]byte(c.PGPSignature)) > 1 {
+		return nil, ErrMultipleSignatures
+	}
+
 	keyRingReader := strings.NewReader(armoredKeyRing)
 	keyring, err := openpgp.ReadArmoredKeyRing(keyRingReader)
 	if err != nil {
@@ -0,0 +1,377 @@
+package object
+
+import (
+	"bufio"
+	"bytes"
+	"fmt"
+	"io"
+	"strings"
+
+	"github.com/go-git/go-git/v5/plumbing"
+)
+
+// commitScanner holds the working state of the commit decoder driven by the
+// stateFn loop in (*Commit).Decode. Each commitState reads one or more lines
+// from r, updates the in-progress *Commit and the scanner's bookkeeping, and
+// returns the state that should run next (or nil to stop).
+type commitScanner struct {
+	r      *bufio.Reader
+	c      *Commit
+	msgbuf bytes.Buffer
+
+	// pending holds a line that was read but the current state decided to
+	// hand back to the next state, paired with the io.EOF flag that was
+	// returned when the line was originally read.
+	pending    []byte
+	pendingErr error
+
+	// First-occurrence tracking: once the corresponding field has been
+	// decoded, subsequent occurrences are silently dropped (matches
+	// upstream's find_commit_header / first-wins semantics).
+	//
+	// gpgsig is not tracked here: upstream's parse_buffer_signed_by_header
+	// (commit.c:1186) accumulates every occurrence into one signature buffer,
+	// so we do the same on the scanner side to keep verification payloads
+	// byte-aligned. gpgsig-sha256 is recognized and skipped without exposing a
+	// new field in v5.
+	sawTree, sawAuthor, sawCommitter bool
+	sawEncoding, sawMergetag         bool
+
+	// extra is the multi-line ExtraHeader currently being assembled.
+	extra *ExtraHeader
+}
+
+// commitState is one step of the decoder state machine. Each function reads
+// the lines it needs, mutates *Commit via s.c, and returns the next state to
+// run (or nil to terminate the loop).
+type commitState func(*commitScanner) (commitState, error)
+
+// readLine returns the next line from the buffer, transparently consuming any
+// line that was previously pushed back by a state that decided not to handle
+// it.
+func (s *commitScanner) readLine() ([]byte, error) {
+	if s.pending != nil {
+		line, err := s.pending, s.pendingErr
+		s.pending, s.pendingErr = nil, nil
+		return line, err
+	}
+	line, err := s.r.ReadBytes('\n')
+	if err != nil && err != io.EOF {
+		return line, err
+	}
+	return line, err
+}
+
+// pushBack stashes an unconsumed line so the next state's readLine call sees
+// it. Only one line can be pushed back at a time.
+func (s *commitScanner) pushBack(line []byte, err error) {
+	s.pending = line
+	s.pendingErr = err
+}
+
+// scanTree expects the first non-empty header to be `tree HASH`. Anything
+// else (or an empty buffer) is rejected with ErrMalformedCommit, matching
+// upstream's `bogus commit object` check.
+func scanTree(s *commitScanner) (commitState, error) {
+	line, err := s.readLine()
+	if err != nil && err != io.EOF {
+		return nil, err
+	}
+	if len(line) == 0 || isBlankLine(line) {
+		return nil, fmt.Errorf("%w: missing tree header", ErrMalformedCommit)
+	}
+
+	key, data := splitHeader(line)
+	if key != "tree" {
+		return nil, fmt.Errorf("%w: tree header must be first", ErrMalformedCommit)
+	}
+	h, herr := parseObjectIDHex(data, ErrMalformedCommit, "tree")
+	if herr != nil {
+		return nil, herr
+	}
+	s.c.TreeHash = h
+	s.sawTree = true
+	if err == io.EOF {
+		return nil, nil
+	}
+	return scanParents, nil
+}
+
+// scanParents consumes contiguous `parent HASH` lines. The first non-parent
+// line ends the parent block and is handed off to scanAuthor; any later
+// `parent` line is silently dropped (matches upstream's parse_commit_buffer
+// exiting its parent loop at the first non-parent line and
+// read_commit_extra_header_lines filtering `parent` out of extras).
+func scanParents(s *commitScanner) (commitState, error) {
+	line, err := s.readLine()
+	if err != nil && err != io.EOF {
+		return nil, err
+	}
+	if len(line) == 0 {
+		return nil, nil
+	}
+	if isBlankLine(line) {
+		return scanMessage, nil
+	}
+
+	key, data := splitHeader(line)
+	if key == "parent" {
+		h, herr := parseObjectIDHex(data, ErrMalformedCommit, "parent")
+		if herr != nil {
+			return nil, herr
+		}
+		s.c.ParentHashes = append(s.c.ParentHashes, h)
+		if err == io.EOF {
+			return nil, nil
+		}
+		return scanParents, nil
+	}
+	s.pushBack(line, err)
+	return scanAuthor, nil
+}
+
+// scanAuthor accepts an `author` line at its canonical position immediately
+// after the parent block. Any other header here is pushed back for
+// scanCommitter; an out-of-place author is therefore silently dropped.
+// Mirrors upstream's parse_commit_date func.
+func scanAuthor(s *commitScanner) (commitState, error) {
+	line, err := s.readLine()
+	if err != nil && err != io.EOF {
+		return nil, err
+	}
+	if len(line) == 0 {
+		return nil, nil
+	}
+	if isBlankLine(line) {
+		return scanMessage, nil
+	}
+
+	key, data := splitHeader(line)
+	if key == "author" {
+		s.c.Author.Decode(data)
+		s.sawAuthor = true
+		if err == io.EOF {
+			return nil, nil
+		}
+		return scanCommitter, nil
+	}
+	s.pushBack(line, err)
+	return scanCommitter, nil
+}
+
+// scanCommitter accepts a `committer` line at its canonical position
+// immediately after the author. Any other header is pushed back for
+// scanHeaders. Same upstream rationale as scanAuthor.
+func scanCommitter(s *commitScanner) (commitState, error) {
+	line, err := s.readLine()
+	if err != nil && err != io.EOF {
+		return nil, err
+	}
+	if len(line) == 0 {
+		return nil, nil
+	}
+	if isBlankLine(line) {
+		return scanMessage, nil
+	}
+
+	key, data := splitHeader(line)
+	if key == "committer" {
+		s.c.Committer.Decode(data)
+		s.sawCommitter = true
+		if err == io.EOF {
+			return nil, nil
+		}
+		return scanHeaders, nil
+	}
+	s.pushBack(line, err)
+	return scanHeaders, nil
+}
+
+// scanHeaders dispatches one header line. Continuation-bearing headers
+// (mergetag, gpgsig, gpgsig-sha256, and unknown extras whose value is
+// continued on subsequent lines) hand off to a dedicated continuation state
+// that handles the `<space>...` lines and then returns here.
+func scanHeaders(s *commitScanner) (commitState, error) {
+	line, err := s.readLine()
+	if err != nil && err != io.EOF {
+		return nil, err
+	}
+	if len(line) == 0 {
+		return nil, nil
+	}
+	if isBlankLine(line) {
+		return scanMessage, nil
+	}
+
+	originalLine := line
+	key, data := splitHeader(line)
+
+	var next commitState = scanHeaders
+	switch key {
+	case "tree", "parent", "author", "committer":
+		// Anything reaching scanHeaders with one of these keys is out of
+		// canonical position: duplicate tree, parent past the contiguous
+		// block, or author/committer not at their expected slot. Drop them
+		// the same way upstream's standard_header_field filter excludes
+		// them from the extras list (read_commit_extra_header_lines,
+		// commit.c:1520-1522).
+	case headerencoding:
+		if !s.sawEncoding {
+			s.c.Encoding = MessageEncoding(data)
+			s.sawEncoding = true
+		}
+	case headermergetag:
+		if s.sawMergetag {
+			next = scanSkipCont
+		} else {
+			s.c.MergeTag += string(data) + "\n"
+			s.sawMergetag = true
+			next = scanMergetagCont
+		}
+	case headerpgp:
+		s.c.PGPSignature += string(data) + "\n"
+		next = scanPgpCont
+	case headerpgp256:
+		next = scanSkipCont
+	default:
+		h, multiline := parseExtraHeader(originalLine)
+		if multiline {
+			s.extra = &h
+			next = scanExtraCont
+		} else {
+			s.c.ExtraHeaders = append(s.c.ExtraHeaders, h)
+		}
+	}
+
+	if err == io.EOF {
+		return nil, nil
+	}
+	return next, nil
+}
+
+// scanMergetagCont accumulates continuation lines for the first mergetag
+// header. Continuations strip exactly one leading space, mirroring upstream's
+// `line + 1` (commit.c:1509). The first non-continuation line is pushed back
+// so scanHeaders can dispatch it.
+func scanMergetagCont(s *commitScanner) (commitState, error) {
+	return continuationCont(s, &s.c.MergeTag, scanMergetagCont)
+}
+
+// scanPgpCont accumulates continuation lines for a signature header.
+// Continuations strip exactly one leading space, mirroring upstream's
+// `line + 1` (commit.c:1509). The first non-continuation line is pushed back
+// so scanHeaders can dispatch it. Repeat occurrences of the same signature
+// header land back here and concatenate, matching upstream's
+// parse_buffer_signed_by_header (commit.c:1186).
+func scanPgpCont(s *commitScanner) (commitState, error) {
+	return continuationCont(s, &s.c.PGPSignature, scanPgpCont)
+}
+
+func continuationCont(s *commitScanner, dst *string, self commitState) (commitState, error) {
+	line, err := s.readLine()
+	if err != nil && err != io.EOF {
+		return nil, err
+	}
+	if len(line) > 0 && line[0] == ' ' {
+		*dst += string(line[1:])
+		if err == io.EOF {
+			return nil, nil
+		}
+		return self, nil
+	}
+	if len(line) > 0 {
+		s.pushBack(line, err)
+	}
+	return scanHeaders, nil
+}
+
+// scanSkipCont discards continuation lines that belong to a header scanHeaders
+// chose to drop.
+func scanSkipCont(s *commitScanner) (commitState, error) {
+	line, err := s.readLine()
+	if err != nil && err != io.EOF {
+		return nil, err
+	}
+	if len(line) > 0 && line[0] == ' ' {
+		if err == io.EOF {
+			return nil, nil
+		}
+		return scanSkipCont, nil
+	}
+	if len(line) > 0 {
+		s.pushBack(line, err)
+	}
+	return scanHeaders, nil
+}
+
+// scanExtraCont accumulates continuation lines for an unknown ExtraHeader
+// whose value spans multiple lines, then finalises the entry once the
+// continuation block ends.
+func scanExtraCont(s *commitScanner) (commitState, error) {
+	line, err := s.readLine()
+	if err != nil && err != io.EOF {
+		return nil, err
+	}
+	if len(line) > 0 && line[0] == ' ' {
+		s.extra.Value += string(line[1:])
+		if err == io.EOF {
+			s.finaliseExtra()
+			return nil, nil
+		}
+		return scanExtraCont, nil
+	}
+	s.finaliseExtra()
+	if len(line) > 0 {
+		s.pushBack(line, err)
+	}
+	return scanHeaders, nil
+}
+
+func (s *commitScanner) finaliseExtra() {
+	s.extra.Value = strings.TrimRight(s.extra.Value, "\n")
+	s.c.ExtraHeaders = append(s.c.ExtraHeaders, *s.extra)
+	s.extra = nil
+}
+
+// scanMessage drains the remaining bytes into the message buffer.
+func scanMessage(s *commitScanner) (commitState, error) {
+	for {
+		line, err := s.readLine()
+		if err != nil && err != io.EOF {
+			return nil, err
+		}
+		if len(line) > 0 {
+			s.msgbuf.Write(line)
+		}
+		if err == io.EOF {
+			return nil, nil
+		}
+	}
+}
+
+// isBlankLine reports whether line is the canonical header/body separator:
+// a single newline. Mirrors upstream's `*line == '\n'` test in
+// read_commit_extra_header_lines (commit.c:1502).
+func isBlankLine(line []byte) bool {
+	return len(line) == 1 && line[0] == '\n'
+}
+
+// splitHeader returns the header keyword (everything before the first space)
+// and the value (everything after, with the trailing newline stripped). If
+// the header has no value the returned data is nil.
+func splitHeader(line []byte) (string, []byte) {
+	trimmed := bytes.TrimRight(line, "\n")
+	key, value, ok := bytes.Cut(trimmed, []byte{' '})
+	if !ok {
+		return string(trimmed), nil
+	}
+	return string(key), value
+}
+
+func parseObjectIDHex(data []byte, malformedErr error, header string) (plumbing.Hash, error) {
+	id := string(data)
+	if !plumbing.IsHash(id) {
+		return plumbing.ZeroHash, fmt.Errorf("%w: bad %s hash", malformedErr, header)
+	}
+	return plumbing.NewHash(id), nil
+}
@@ -1,6 +1,13 @@
 package object

-import "bytes"
+import (
+	"bytes"
+	"io"
+
+	"github.com/go-git/go-git/v5/plumbing"
+	"github.com/go-git/go-git/v5/utils/ioutil"
+	"github.com/go-git/go-git/v5/utils/sync"
+)

 const (
 	signatureTypeUnknown signatureType = iota
@@ -100,3 +107,116 @@ func parseSignedBytes(b []byte) (int, signatureType) {
 	}
 	return match, t
 }
+
+// countSignatureBlocks reports how many distinct armored signature blocks
+// start at a line boundary in b. Used by verification paths to reject
+// multi-signature payloads, matching upstream's check in gpg-interface.c
+// where parse_gpg_output bails out the first time it sees a second
+// exclusive status line (a second GOODSIG/BADSIG/etc.).
+func countSignatureBlocks(b []byte) int {
+	n, count := 0, 0
+	for n < len(b) {
+		i := b[n:]
+		if typeForSignature(i) != signatureTypeUnknown {
+			count++
+		}
+		if eol := bytes.IndexByte(i, '\n'); eol >= 0 {
+			n += eol + 1
+			continue
+		}
+		break
+	}
+	return count
+}
+
+// isSignatureHeader reports whether line is a canonical "gpgsig "/
+// "gpgsig-sha256 " header line. Other "gpgsig"-prefixed extra headers
+// are intentionally not matched.
+func isSignatureHeader(line []byte) bool {
+	return bytes.HasPrefix(line, []byte(headerpgp+" ")) ||
+		bytes.HasPrefix(line, []byte(headerpgp256+" "))
+}
+
+// stripObjectSignatures streams src into dst, producing the byte sequence
+// over which a PGP/GPG signature is computed:
+//
+//   - Canonical "gpgsig" and "gpgsig-sha256" headers (and their
+//     continuation lines) are dropped, mirroring upstream's
+//     remove_signature in commit.c.
+//   - For tag objects, the inline trailing PGP signature is additionally
+//     truncated, mirroring upstream's parse_signature in gpg-interface.c
+//     used by gpg_verify_tag.
+//
+// The returned object's type is set to objType. Used by both
+// Commit.EncodeWithoutSignature and Tag.EncodeWithoutSignature to
+// reproduce the exact bytes the signature was computed over.
+func stripObjectSignatures(dst, src plumbing.EncodedObject, objType plumbing.ObjectType) (err error) {
+	dst.SetType(objType)
+
+	r, err := src.Reader()
+	if err != nil {
+		return err
+	}
+	defer ioutil.CheckClose(r, &err)
+
+	var input io.Reader = r
+	if objType == plumbing.TagObject {
+		raw, err := io.ReadAll(r)
+		if err != nil {
+			return err
+		}
+		if sm, _ := parseSignedBytes(raw); sm >= 0 {
+			raw = raw[:sm]
+		}
+		input = bytes.NewReader(raw)
+	}
+
+	w, err := dst.Writer()
+	if err != nil {
+		return err
+	}
+	defer ioutil.CheckClose(w, &err)
+
+	return stripHeaderSignatures(w, input)
+}
+
+// stripHeaderSignatures copies r to w, dropping canonical signature header
+// lines (gpgsig and gpgsig-sha256) and their continuation lines. Lines
+// past the blank line that closes the header block are copied verbatim.
+func stripHeaderSignatures(w io.Writer, r io.Reader) error {
+	br := sync.GetBufioReader(r)
+	defer sync.PutBufioReader(br)
+
+	var inBody, skipping bool
+	for {
+		line, rerr := br.ReadBytes('\n')
+		if rerr != nil && rerr != io.EOF {
+			return rerr
+		}
+
+		write := true
+		if !inBody {
+			switch {
+			case skipping && len(line) > 0 && line[0] == ' ':
+				write = false
+			case isSignatureHeader(line):
+				skipping = true
+				write = false
+			case len(line) == 1 && line[0] == '\n':
+				skipping = false
+				inBody = true
+			default:
+				skipping = false
+			}
+		}
+
+		if write && len(line) > 0 {
+			if _, werr := w.Write(line); werr != nil {
+				return werr
+			}
+		}
+		if rerr == io.EOF {
+			return nil
+		}
+	}
+}
@@ -1,9 +1,8 @@
 package object

 import (
-	"bytes"
+	"errors"
 	"fmt"
-	"io"
 	"strings"

 	"github.com/ProtonMail/go-crypto/openpgp"
@@ -13,6 +12,10 @@ import (
 	"github.com/go-git/go-git/v5/utils/sync"
 )

+// ErrMalformedTag is returned when a tag object cannot be decoded because
+// its required headers (object, type, tag) are missing or out of order.
+var ErrMalformedTag = errors.New("malformed tag")
+
 // Tag represents an annotated tag object. It points to a single git object of
 // any type, but tags typically are applied to commit or blob objects. It
 // provides a reference that associates the target with a tag name. It also
@@ -39,6 +42,9 @@ type Tag struct {
 	Target plumbing.Hash

 	s storer.EncodedObjectStorer
+	// src holds the encoded object this Tag was decoded from, used by
+	// EncodeWithoutSignature to recover the canonical signed bytes.
+	src plumbing.EncodedObject
 }

 // GetTag gets a tag from an object storer and decodes it.
@@ -77,13 +83,20 @@ func (t *Tag) Type() plumbing.ObjectType {
 	return plumbing.TagObject
 }

+func (t *Tag) reset() {
+	storer := t.s
+	*t = Tag{s: storer}
+}
+
 // Decode transforms a plumbing.EncodedObject into a Tag struct.
 func (t *Tag) Decode(o plumbing.EncodedObject) (err error) {
 	if o.Type() != plumbing.TagObject {
 		return ErrUnsupportedObject
 	}

+	t.reset()
 	t.Hash = o.Hash()
+	t.src = o

 	reader, err := o.Reader()
 	if err != nil {
@@ -94,42 +107,15 @@ func (t *Tag) Decode(o plumbing.EncodedObject) (err error) {
 	r := sync.GetBufioReader(reader)
 	defer sync.PutBufioReader(r)

-	for {
-		var line []byte
-		line, err = r.ReadBytes('\n')
-		if err != nil && err != io.EOF {
+	scanner := &tagScanner{r: r, t: t}
+	for state := scanTagObject; state != nil; {
+		state, err = state(scanner)
+		if err != nil {
 			return err
 		}
-
-		line = bytes.TrimSpace(line)
-		if len(line) == 0 {
-			break // Start of message
-		}
-
-		split := bytes.SplitN(line, []byte{' '}, 2)
-		switch string(split[0]) {
-		case "object":
-			t.Target = plumbing.NewHash(string(split[1]))
-		case "type":
-			t.TargetType, err = plumbing.ParseObjectType(string(split[1]))
-			if err != nil {
-				return err
-			}
-		case "tag":
-			t.Name = string(split[1])
-		case "tagger":
-			t.Tagger.Decode(split[1])
-		}
-
-		if err == io.EOF {
-			return nil
-		}
 	}

-	data, err := io.ReadAll(r)
-	if err != nil {
-		return err
-	}
+	data := scanner.msgbuf.Bytes()
 	if sm, _ := parseSignedBytes(data); sm >= 0 {
 		t.PGPSignature = string(data[sm:])
 		data = data[:sm]
@@ -144,11 +130,54 @@ func (t *Tag) Encode(o plumbing.EncodedObject) error {
 	return t.encode(o, true)
 }

-// EncodeWithoutSignature export a Tag into a plumbing.EncodedObject without the signature (correspond to the payload of the PGP signature).
+// EncodeWithoutSignature exports a Tag into a plumbing.EncodedObject without
+// any signature data, producing the payload that PGP/GPG signatures are
+// computed over.
+//
+// Behaviour mirrors Commit.EncodeWithoutSignature:
+//
+//   - For Tags populated by Decode whose exported fields still match the
+//     source object, the payload is streamed from the raw source bytes with
+//     the inline trailing signature truncated and gpgsig/gpgsig-sha256
+//     headers (and their continuation lines) stripped verbatim. This
+//     preserves the exact bytes the signature was computed over, regardless
+//     of any normalization performed by Decode.
+//
+//   - For Tags constructed in memory, or for decoded Tags whose exported
+//     fields have been mutated, the payload is derived from the current
+//     struct fields. Mutation is detected by re-decoding the source object
+//     and comparing exported fields; if any differ, the in-memory
+//     representation prevails.
 func (t *Tag) EncodeWithoutSignature(o plumbing.EncodedObject) error {
+	if t.matchesSource() {
+		return stripObjectSignatures(o, t.src, plumbing.TagObject)
+	}
 	return t.encode(o, false)
 }

+// matchesSource reports whether t.src is set and re-decoding it produces a
+// Tag whose payload-affecting exported fields are identical to those of t.
+//
+// PGPSignature is intentionally excluded from the comparison: neither path
+// emits it as part of the verification payload, so mutating it must not
+// trigger a switch to struct-encode (which would change the byte layout the
+// caller is trying to verify against).
+func (t *Tag) matchesSource() bool {
+	if t.src == nil {
+		return false
+	}
+	fresh := &Tag{}
+	if err := fresh.Decode(t.src); err != nil {
+		return false
+	}
+	return t.Hash == fresh.Hash &&
+		t.Name == fresh.Name &&
+		signatureEqual(t.Tagger, fresh.Tagger) &&
+		t.Message == fresh.Message &&
+		t.TargetType == fresh.TargetType &&
+		t.Target == fresh.Target
+}
+
 func (t *Tag) encode(o plumbing.EncodedObject, includeSig bool) (err error) {
 	o.SetType(plumbing.TagObject)
 	w, err := o.Writer()
@@ -158,16 +187,26 @@ func (t *Tag) encode(o plumbing.EncodedObject, includeSig bool) (err error) {
 	defer ioutil.CheckClose(w, &err)

 	if _, err = fmt.Fprintf(w,
-		"object %s\ntype %s\ntag %s\ntagger ",
+		"object %s\ntype %s\ntag %s\n",
 		t.Target.String(), t.TargetType.Bytes(), t.Name); err != nil {
 		return err
 	}

-	if err = t.Tagger.Encode(w); err != nil {
-		return err
+	if !isZeroSignature(t.Tagger) {
+		if _, err = fmt.Fprint(w, "tagger "); err != nil {
+			return err
+		}
+
+		if err = t.Tagger.Encode(w); err != nil {
+			return err
+		}
+
+		if _, err = fmt.Fprint(w, "\n"); err != nil {
+			return err
+		}
 	}

-	if _, err = fmt.Fprint(w, "\n\n"); err != nil {
+	if _, err = fmt.Fprint(w, "\n"); err != nil {
 		return err
 	}

@@ -175,11 +214,12 @@ func (t *Tag) encode(o plumbing.EncodedObject, includeSig bool) (err error) {
 		return err
 	}

-	// Note that this is highly sensitive to what it sent along in the message.
-	// Message *always* needs to end with a newline, or else the message and the
-	// signature will be concatenated into a corrupt object. Since this is a
-	// lower-level method, we assume you know what you are doing and have already
-	// done the needful on the message in the caller.
+	// Note that this is highly sensitive to what is sent along in the
+	// message. Message *always* needs to end with a newline, or else the
+	// message and the trailing signature will be concatenated into a
+	// corrupt object. Since this is a lower-level method, we assume you
+	// know what you are doing and have already done the needful on the
+	// message in the caller.
 	if includeSig {
 		if _, err = fmt.Fprint(w, t.PGPSignature); err != nil {
 			return err
@@ -189,6 +229,10 @@ func (t *Tag) encode(o plumbing.EncodedObject, includeSig bool) (err error) {
 	return err
 }

+func isZeroSignature(s Signature) bool {
+	return s.Name == "" && s.Email == "" && s.When.IsZero()
+}
+
 // Commit returns the commit pointed to by the tag. If the tag points to a
 // different type of object ErrUnsupportedObject will be returned.
 func (t *Tag) Commit() (*Commit, error) {
@@ -256,7 +300,8 @@ func (t *Tag) String() string {
 }

 // Verify performs PGP verification of the tag with a provided armored
-// keyring and returns openpgp.Entity associated with verifying key on success.
+// keyring and returns openpgp.Entity associated with verifying key on
+// success.
 func (t *Tag) Verify(armoredKeyRing string) (*openpgp.Entity, error) {
 	keyRingReader := strings.NewReader(armoredKeyRing)
 	keyring, err := openpgp.ReadArmoredKeyRing(keyRingReader)
@@ -0,0 +1,237 @@
+package object
+
+import (
+	"bufio"
+	"bytes"
+	"fmt"
+	"io"
+
+	"github.com/go-git/go-git/v5/plumbing"
+)
+
+// tagScanner holds the working state of the tag decoder driven by the
+// stateFn loop in (*Tag).Decode. Each tagState reads one or more lines
+// from r, updates the in-progress *Tag and the scanner's bookkeeping,
+// and returns the state that should run next (or nil to stop).
+type tagScanner struct {
+	r      *bufio.Reader
+	t      *Tag
+	msgbuf bytes.Buffer
+
+	// pending holds a line that was read but the current state decided to
+	// hand back to the next state, paired with the io.EOF flag returned
+	// when the line was originally read.
+	pending    []byte
+	pendingErr error
+
+	// First-occurrence tracking: once the corresponding canonical
+	// header has been decoded at its expected position, subsequent
+	// occurrences (or out-of-position lines) are silently dropped,
+	// matching the strict layout enforced by upstream's
+	// parse_tag_buffer (tag.c:130).
+	//
+	// gpgsig-sha256 is recognized and skipped without exposing a new field
+	// in v5.
+	sawObject, sawType, sawName, sawTagger bool
+}
+
+// tagState is one step of the decoder state machine. Each function reads
+// the lines it needs, mutates *Tag via s.t, and returns the next state
+// to run (or nil to terminate the loop).
+type tagState func(*tagScanner) (tagState, error)
+
+// readLine returns the next line from the buffer, transparently
+// consuming any line that was previously pushed back by a state that
+// decided not to handle it.
+func (s *tagScanner) readLine() ([]byte, error) {
+	if s.pending != nil {
+		line, err := s.pending, s.pendingErr
+		s.pending, s.pendingErr = nil, nil
+		return line, err
+	}
+	return s.r.ReadBytes('\n')
+}
+
+// pushBack stashes an unconsumed line so the next state's readLine call
+// sees it. Only one line can be pushed back at a time.
+func (s *tagScanner) pushBack(line []byte, err error) {
+	s.pending = line
+	s.pendingErr = err
+}
+
+// scanTagObject requires the first line to be `object HASH`, mirroring
+// upstream's strict parse_tag_buffer (tag.c:151-156). Anything else
+// returns ErrMalformedTag.
+func scanTagObject(s *tagScanner) (tagState, error) {
+	line, err := s.readLine()
+	if err != nil && err != io.EOF {
+		return nil, err
+	}
+	if len(line) == 0 || isBlankLine(line) {
+		return nil, fmt.Errorf("%w: missing object header", ErrMalformedTag)
+	}
+
+	key, data := splitHeader(line)
+	if key != "object" {
+		return nil, fmt.Errorf("%w: object header must be first", ErrMalformedTag)
+	}
+	h, herr := parseObjectIDHex(data, ErrMalformedTag, "object")
+	if herr != nil {
+		return nil, herr
+	}
+	s.t.Target = h
+	s.sawObject = true
+	if err == io.EOF {
+		return nil, nil
+	}
+	return scanTagType, nil
+}
+
+// scanTagType requires a `type` line immediately after the object header,
+// mirroring upstream's parse_tag_buffer (tag.c:158-166).
+func scanTagType(s *tagScanner) (tagState, error) {
+	line, err := s.readLine()
+	if err != nil && err != io.EOF {
+		return nil, err
+	}
+	if len(line) == 0 || isBlankLine(line) {
+		return nil, fmt.Errorf("%w: missing type header", ErrMalformedTag)
+	}
+
+	key, data := splitHeader(line)
+	if key != "type" {
+		return nil, fmt.Errorf("%w: type header must follow object", ErrMalformedTag)
+	}
+	ot, perr := plumbing.ParseObjectType(string(data))
+	if perr != nil {
+		return nil, perr
+	}
+	s.t.TargetType = ot
+	s.sawType = true
+	if err == io.EOF {
+		return nil, nil
+	}
+	return scanTagName, nil
+}
+
+// scanTagName requires a `tag` line immediately after the type header,
+// mirroring upstream's parse_tag_buffer (tag.c:186-194).
+func scanTagName(s *tagScanner) (tagState, error) {
+	line, err := s.readLine()
+	if err != nil && err != io.EOF {
+		return nil, err
+	}
+	if len(line) == 0 || isBlankLine(line) {
+		return nil, fmt.Errorf("%w: missing tag header", ErrMalformedTag)
+	}
+
+	key, data := splitHeader(line)
+	if key != "tag" {
+		return nil, fmt.Errorf("%w: tag header must follow type", ErrMalformedTag)
+	}
+	s.t.Name = string(data)
+	s.sawName = true
+	if err == io.EOF {
+		return nil, nil
+	}
+	return scanTagTagger, nil
+}
+
+// scanTagTagger accepts a `tagger` line at its canonical position. Any
+// other header is pushed back for scanTagHeaders.
+func scanTagTagger(s *tagScanner) (tagState, error) {
+	line, err := s.readLine()
+	if err != nil && err != io.EOF {
+		return nil, err
+	}
+	if len(line) == 0 {
+		return nil, nil
+	}
+	if isBlankLine(line) {
+		return scanTagMessage, nil
+	}
+
+	key, data := splitHeader(line)
+	if key == "tagger" {
+		s.t.Tagger.Decode(data)
+		s.sawTagger = true
+		if err == io.EOF {
+			return nil, nil
+		}
+		return scanTagHeaders, nil
+	}
+	s.pushBack(line, err)
+	return scanTagHeaders, nil
+}
+
+// scanTagHeaders dispatches one header line. gpgsig-sha256 hands off to
+// scanTagSkipCont so the continuation block can be consumed; out-of-position
+// canonical fields and unknown headers are silently dropped.
+func scanTagHeaders(s *tagScanner) (tagState, error) {
+	line, err := s.readLine()
+	if err != nil && err != io.EOF {
+		return nil, err
+	}
+	if len(line) == 0 {
+		return nil, nil
+	}
+	if isBlankLine(line) {
+		return scanTagMessage, nil
+	}
+
+	key, _ := splitHeader(line)
+	next := scanTagHeaders
+	switch key {
+	case "object", "type", "tag", "tagger":
+		// Out-of-canonical-position duplicates are dropped, mirroring the
+		// strict ordering of upstream's parse_tag_buffer.
+	case headerpgp256:
+		next = scanTagSkipCont
+	default:
+		// Unknown header: silently dropped (the Tag struct does not
+		// expose ExtraHeaders).
+	}
+
+	if err == io.EOF {
+		return nil, nil
+	}
+	return next, nil
+}
+
+// scanTagSkipCont discards continuation lines for a header scanTagHeaders chose
+// to drop. The first non-continuation line is pushed back so scanTagHeaders can
+// dispatch it.
+func scanTagSkipCont(s *tagScanner) (tagState, error) {
+	line, err := s.readLine()
+	if err != nil && err != io.EOF {
+		return nil, err
+	}
+	if len(line) > 0 && line[0] == ' ' {
+		if err == io.EOF {
+			return nil, nil
+		}
+		return scanTagSkipCont, nil
+	}
+	if len(line) > 0 {
+		s.pushBack(line, err)
+	}
+	return scanTagHeaders, nil
+}
+
+// scanTagMessage drains the remaining bytes into the message buffer.
+// (*Tag).Decode then runs parseSignedBytes over those bytes to peel off
+// the optional inline trailing PGP signature.
+func scanTagMessage(s *tagScanner) (tagState, error) {
+	for {
+		line, err := s.readLine()
+		if err != nil && err != io.EOF {
+			return nil, err
+		}
+		if len(line) > 0 {
+			s.msgbuf.Write(line)
+		}
+		if err == io.EOF {
+			return nil, nil
+		}
+	}
+}
@@ -10,6 +10,7 @@ import (
 	"sort"
 	"strings"

+	"github.com/go-git/go-git/v5/internal/pathutil"
 	"github.com/go-git/go-git/v5/plumbing"
 	"github.com/go-git/go-git/v5/plumbing/filemode"
 	"github.com/go-git/go-git/v5/plumbing/storer"
@@ -29,6 +30,7 @@ var (
 	ErrDirectoryNotFound = errors.New("directory not found")
 	ErrEntryNotFound     = errors.New("entry not found")
 	ErrEntriesNotSorted  = errors.New("entries in tree are not sorted")
+	ErrMalformedTree     = errors.New("malformed tree")
 )

 // Tree is basically like a directory - it references a bunch of other trees
@@ -37,9 +39,9 @@ type Tree struct {
 	Entries []TreeEntry
 	Hash    plumbing.Hash

-	s storer.EncodedObjectStorer
-	m map[string]*TreeEntry
-	t map[string]*Tree // tree path cache
+	s             storer.EncodedObjectStorer
+	t             map[string]*Tree // tree path cache
+	entriesSorted bool
 }

 // GetTree gets a tree from an object storer and decodes it.
@@ -117,7 +119,16 @@ func (t *Tree) Tree(path string) (*Tree, error) {
 }

 // TreeEntryFile returns the *File for a given *TreeEntry.
+//
+// The entry's name is validated against pathutil.ValidTreePath for
+// the same reason FindEntry validates: TreeEntryFile is a boundary
+// where attacker-controlled tree data leaves the trusted store as a
+// *File whose Name a caller can hand to filesystem ops.
 func (t *Tree) TreeEntryFile(e *TreeEntry) (*File, error) {
+	if err := pathutil.ValidTreePath(e.Name); err != nil {
+		return nil, err
+	}
+
 	blob, err := GetBlob(t.s, e.Hash)
 	if err != nil {
 		return nil, err
@@ -127,7 +138,16 @@ func (t *Tree) TreeEntryFile(e *TreeEntry) (*File, error) {
 }

 // FindEntry search a TreeEntry in this tree or any subtree.
+//
+// The lookup path is validated against pathutil.ValidTreePath to
+// prevent attacker-controlled tree contents from leaking past this
+// boundary as `.git`-shaped or path-traversal-shaped names. Callers
+// that legitimately need to look up unsafe paths should walk the
+// tree manually.
 func (t *Tree) FindEntry(path string) (*TreeEntry, error) {
+	if err := pathutil.ValidTreePath(path); err != nil {
+		return nil, err
+	}
 	if t.t == nil {
 		t.t = make(map[string]*Tree)
 	}
@@ -182,16 +202,43 @@ func (t *Tree) dir(baseName string) (*Tree, error) {
 }

 func (t *Tree) entry(baseName string) (*TreeEntry, error) {
-	if t.m == nil {
-		t.buildMap()
-	}
-
-	entry, ok := t.m[baseName]
-	if !ok {
+	if t.entriesSorted {
+		if entry := t.searchEntry(baseName); entry != nil {
+			return entry, nil
+		}
 		return nil, ErrEntryNotFound
 	}

-	return entry, nil
+	pastName := baseName + "/"
+	for i := range t.Entries {
+		entry := &t.Entries[i]
+		if entry.Name == baseName {
+			return entry, nil
+		}
+		if treeEntrySortName(entry) > pastName {
+			break
+		}
+	}
+
+	return nil, ErrEntryNotFound
+}
+
+func (t *Tree) searchEntry(baseName string) *TreeEntry {
+	if i := t.searchEntryIndex(baseName); i < len(t.Entries) && t.Entries[i].Name == baseName {
+		return &t.Entries[i]
+	}
+
+	if i := t.searchEntryIndex(baseName + "/"); i < len(t.Entries) && t.Entries[i].Name == baseName {
+		return &t.Entries[i]
+	}
+
+	return nil
+}
+
+func (t *Tree) searchEntryIndex(name string) int {
+	return sort.Search(len(t.Entries), func(i int) bool {
+		return treeEntrySortName(&t.Entries[i]) >= name
+	})
 }

 // Files returns a FileIter allowing to iterate over the Tree
@@ -212,20 +259,25 @@ func (t *Tree) Type() plumbing.ObjectType {
 	return plumbing.TreeObject
 }

+func (t *Tree) reset() {
+	storer := t.s
+	*t = Tree{s: storer}
+}
+
 // Decode transform an plumbing.EncodedObject into a Tree struct
 func (t *Tree) Decode(o plumbing.EncodedObject) (err error) {
 	if o.Type() != plumbing.TreeObject {
 		return ErrUnsupportedObject
 	}

+	t.reset()
 	t.Hash = o.Hash()
+	// assume tree is sorted as a valid tree should always be sorted.
+	t.entriesSorted = true
 	if o.Size() == 0 {
 		return nil
 	}

-	t.Entries = nil
-	t.m = nil
-
 	reader, err := o.Reader()
 	if err != nil {
 		return err
@@ -235,10 +287,14 @@ func (t *Tree) Decode(o plumbing.EncodedObject) (err error) {
 	r := sync.GetBufioReader(reader)
 	defer sync.PutBufioReader(r)

+	var prevSortName string
 	for {
 		str, err := r.ReadString(' ')
 		if err != nil {
 			if err == io.EOF {
+				if len(str) != 0 {
+					return fmt.Errorf("%w: missing mode terminator", ErrMalformedTree)
+				}
 				break
 			}

@@ -248,25 +304,41 @@ func (t *Tree) Decode(o plumbing.EncodedObject) (err error) {

 		mode, err := filemode.New(str)
 		if err != nil {
-			return err
+			return fmt.Errorf("%w: malformed mode", ErrMalformedTree)
 		}
+		mode = canonicalTreeMode(mode)

 		name, err := r.ReadString(0)
-		if err != nil && err != io.EOF {
+		if err != nil {
+			if err == io.EOF {
+				return fmt.Errorf("%w: missing filename terminator", ErrMalformedTree)
+			}
 			return err
 		}
+		if len(name) == 1 {
+			return fmt.Errorf("%w: empty filename", ErrMalformedTree)
+		}

 		var hash plumbing.Hash
 		if _, err = io.ReadFull(r, hash[:]); err != nil {
+			if errors.Is(err, io.EOF) || errors.Is(err, io.ErrUnexpectedEOF) {
+				return fmt.Errorf("%w: truncated object id", ErrMalformedTree)
+			}
 			return err
 		}

 		baseName := name[:len(name)-1]
-		t.Entries = append(t.Entries, TreeEntry{
+		entry := TreeEntry{
 			Hash: hash,
 			Mode: mode,
 			Name: baseName,
-		})
+		}
+		sortName := treeEntrySortName(&entry)
+		if len(t.Entries) != 0 && prevSortName > sortName {
+			t.entriesSorted = false
+		}
+		prevSortName = sortName
+		t.Entries = append(t.Entries, entry)
 	}

 	return nil
@@ -279,21 +351,37 @@ func (s TreeEntrySorter) Len() int {
 }

 func (s TreeEntrySorter) Less(i, j int) bool {
-	name1 := s[i].Name
-	name2 := s[j].Name
-	if s[i].Mode == filemode.Dir {
-		name1 += "/"
-	}
-	if s[j].Mode == filemode.Dir {
-		name2 += "/"
-	}
-	return name1 < name2
+	return treeEntrySortName(&s[i]) < treeEntrySortName(&s[j])
 }

 func (s TreeEntrySorter) Swap(i, j int) {
 	s[i], s[j] = s[j], s[i]
 }

+// Git compares tree entries as if directory names had a trailing slash.
+func treeEntrySortName(e *TreeEntry) string {
+	if e.Mode == filemode.Dir {
+		return e.Name + "/"
+	}
+	return e.Name
+}
+
+func canonicalTreeMode(mode filemode.FileMode) filemode.FileMode {
+	switch mode & 0o170000 {
+	case 0o040000:
+		return filemode.Dir
+	case 0o100000:
+		if mode&0o111 != 0 {
+			return filemode.Executable
+		}
+		return filemode.Regular
+	case 0o120000:
+		return filemode.Symlink
+	default:
+		return filemode.Submodule
+	}
+}
+
 // Encode transforms a Tree into a plumbing.EncodedObject.
 // The tree entries must be sorted by name.
 func (t *Tree) Encode(o plumbing.EncodedObject) (err error) {
@@ -329,13 +417,6 @@ func (t *Tree) Encode(o plumbing.EncodedObject) (err error) {
 	return err
 }

-func (t *Tree) buildMap() {
-	t.m = make(map[string]*TreeEntry)
-	for i := 0; i < len(t.Entries); i++ {
-		t.m[t.Entries[i].Name] = &t.Entries[i]
-	}
-}
-
 // Diff returns a list of changes between this tree and the provided one
 func (t *Tree) Diff(to *Tree) (Changes, error) {
 	return t.DiffContext(context.Background(), to)
@@ -393,6 +474,14 @@ type TreeWalker struct {
 	recursive bool
 	seen      map[plumbing.Hash]bool

+	// skipPathValidation disables the pathutil.ValidTreePath check in Next.
+	// It is set by inspection-only callers (e.g. the revlist object walk)
+	// that never funnel entry names into the filesystem and must enumerate
+	// trees faithfully, including entries with names upstream Git accepts
+	// but that are unsafe to materialise (control characters, `.git`-shaped
+	// names).
+	skipPathValidation bool
+
 	s storer.EncodedObjectStorer
 	t *Tree
 }
@@ -415,10 +504,32 @@ func NewTreeWalker(t *Tree, recursive bool, seen map[plumbing.Hash]bool) *TreeWa
 	}
 }

+// SkipPathValidation disables the pathutil.ValidTreePath check performed by
+// Next, and must be called before the first Next.
+//
+// It is for inspection-only walks that never funnel an entry name into the
+// filesystem — enumerating which objects exist, rather than materialising
+// them — and that must therefore see the tree faithfully, including entries
+// whose names upstream Git accepts but that are unsafe to check out. Callers
+// that hand the returned name to filesystem or archive output must not use
+// it; path safety for those is enforced at the materialisation boundaries
+// (FindEntry, TreeEntryFile, archive, FileIter).
+func (w *TreeWalker) SkipPathValidation() {
+	w.skipPathValidation = true
+}
+
 // Next returns the next object from the tree. Objects are returned in order
 // and subtrees are included. After the last object has been returned further
 // calls to Next() will return io.EOF.
 //
+// Each entry's name is validated against pathutil.ValidTreePath as it
+// surfaces, so callers that funnel the returned name into filesystem
+// or archive output can trust it is free of `.git`-shaped components,
+// HFS+/NTFS variants, Windows reserved names, and traversal sequences.
+// A malformed entry stops the walk with the validator's error;
+// inspection-only callers that need to enumerate raw, unvalidated
+// names can read Tree.Entries directly or call SkipPathValidation.
+//
 // In the current implementation any objects which cannot be found in the
 // underlying repository will be skipped automatically. It is possible that this
 // may change in future versions.
@@ -455,6 +566,12 @@ func (w *TreeWalker) Next() (name string, entry TreeEntry, err error) {
 			continue
 		}

+		if !w.skipPathValidation {
+			if err := pathutil.ValidTreePath(entry.Name); err != nil {
+				return name, entry, err
+			}
+		}
+
 		if entry.Mode == filemode.Dir {
 			obj, err = GetTree(w.s, entry.Hash)
 		}
@@ -106,6 +106,12 @@ func transformChildren(t *Tree) ([]noder.Noder, error) {
 	ret := make([]noder.Noder, 0, len(t.Entries))

 	walker := NewTreeWalker(t, false, nil) // don't recurse
+	// The diff walk is read-only and never materialises entry names into the
+	// filesystem, so it must enumerate the tree faithfully — including entries
+	// with names that are unsafe to check out but valid per upstream Git (e.g.
+	// control characters). Path safety is enforced at materialisation
+	// boundaries (FindEntry, TreeEntryFile, archive, FileIter), not here.
+	walker.SkipPathValidation()
 	// don't defer walker.Close() for efficiency reasons.
 	for {
 		_, e, err = walker.Next()
@@ -110,6 +110,48 @@ func (r ReferenceName) IsTag() bool {
 	return strings.HasPrefix(string(r), refTagPrefix)
 }

+// IsSafe reports whether the reference name can be safely turned into a path
+// under the .git directory, mirroring Git's refname_is_safe (refs.c). A name
+// is safe when it is either:
+//
+//   - under "refs/", non-empty after the prefix, containing no backslash and
+//     no empty, "." or ".." path component (so it cannot escape the refs/
+//     sub-tree, or alias another name, once turned into a path); or
+//   - a one-level pseudo-ref whose spelling is restricted to [A-Z_]
+//     (e.g. HEAD, ORIG_HEAD, FETCH_HEAD).
+//
+// Everything else — a lowercase or mixed one-level name such as "config" or
+// "index", an absolute or drive-prefixed name, or a refs/ name that escapes —
+// is unsafe, because it could resolve onto unrelated repository metadata.
+func (r ReferenceName) IsSafe() bool {
+	s := string(r)
+	if s == "" {
+		return false
+	}
+
+	if rest, ok := strings.CutPrefix(s, refPrefix); ok {
+		// '\' is a path separator on Windows, so a refs/ name containing one
+		// could escape the sub-tree or alias another name once turned into a
+		// path; reject it outright (check_refname_format forbids '\' too).
+		if rest == "" || strings.Contains(rest, "\\") {
+			return false
+		}
+		for part := range strings.SplitSeq(rest, "/") {
+			if part == "" || part == "." || part == ".." {
+				return false
+			}
+		}
+		return true
+	}
+
+	for i := 0; i < len(s); i++ {
+		if (s[i] < 'A' || s[i] > 'Z') && s[i] != '_' {
+			return false
+		}
+	}
+	return true
+}
+
 func (r ReferenceName) String() string {
 	return string(r)
 }
@@ -187,6 +187,13 @@ func iterateCommitTrees(
 	cb(tree.Hash)

 	treeWalker := object.NewTreeWalker(tree, true, seen)
+	// This walk only enumerates which objects are reachable, to decide what
+	// to send; it never materialises an entry name into the filesystem. It
+	// must therefore enumerate the tree faithfully, including entries with
+	// names that are unsafe to check out but valid per upstream Git (e.g.
+	// control characters). Path safety is enforced at materialisation
+	// boundaries (FindEntry, TreeEntryFile, archive, FileIter), not here.
+	treeWalker.SkipPathValidation()

 	for {
 		_, e, err := treeWalker.Next()
@@ -6,9 +6,12 @@ import (
 	"context"
 	"crypto/tls"
 	"crypto/x509"
+	"errors"
 	"fmt"
+	"io"
 	"net"
 	"net/http"
+	"net/netip"
 	"net/url"
 	"reflect"
 	"strconv"
@@ -24,6 +27,33 @@ import (
 	"github.com/go-git/go-git/v5/utils/ioutil"
 )

+type contextKey int
+
+const initialRequestKey contextKey = iota
+
+// RedirectPolicy controls how the HTTP transport follows redirects.
+//
+// The values mirror Git's http.followRedirects config:
+// "true" follows redirects for all requests, "false" treats redirects as
+// errors, and "initial" follows redirects only for the initial
+// /info/refs discovery request. The zero value defaults to "initial".
+type RedirectPolicy string
+
+const (
+	FollowInitialRedirects RedirectPolicy = "initial"
+	FollowRedirects        RedirectPolicy = "true"
+	NoFollowRedirects      RedirectPolicy = "false"
+)
+
+func withInitialRequest(ctx context.Context) context.Context {
+	return context.WithValue(ctx, initialRequestKey, true)
+}
+
+func isInitialRequest(req *http.Request) bool {
+	v, _ := req.Context().Value(initialRequestKey).(bool)
+	return v
+}
+
 // it requires a bytes.Buffer, because we need to know the length
 func applyHeadersToRequest(req *http.Request, content *bytes.Buffer, host string, requestType string) {
 	req.Header.Add("User-Agent", capability.DefaultAgent())
@@ -47,19 +77,22 @@ func advertisedReferences(ctx context.Context, s *session, serviceName string) (
 		s.endpoint.String(), infoRefsPath, serviceName,
 	)

-	req, err := http.NewRequest(http.MethodGet, url, nil)
+	req, err := newRequest(http.MethodGet, url, nil)
 	if err != nil {
 		return nil, err
 	}

 	s.ApplyAuthToRequest(req)
 	applyHeadersToRequest(req, nil, s.endpoint.Host, serviceName)
-	res, err := s.client.Do(req.WithContext(ctx))
+	res, err := s.client.Do(req.WithContext(withInitialRequest(ctx)))
 	if err != nil {
 		return nil, err
 	}

-	s.ModifyEndpointIfRedirect(res)
+	if err := s.ModifyEndpointIfRedirect(res); err != nil {
+		_ = res.Body.Close()
+		return nil, err
+	}
 	defer ioutil.CheckClose(res.Body, &err)

 	if err = NewErr(res); err != nil {
@@ -96,6 +129,7 @@ type client struct {
 	client     *http.Client
 	transports *lru.Cache
 	mutex      sync.RWMutex
+	follow     RedirectPolicy
 }

 // ClientOptions holds user configurable options for the client.
@@ -106,6 +140,11 @@ type ClientOptions struct {
 	// size, will result in the least recently used transport getting deleted
 	// before the provided transport is added to the cache.
 	CacheMaxEntries int
+
+	// RedirectPolicy controls redirect handling. Supported values are
+	// "true", "false", and "initial". The zero value defaults to
+	// "initial", matching Git's http.followRedirects default.
+	RedirectPolicy RedirectPolicy
 }

 var (
@@ -142,6 +181,24 @@ func NewClient(c *http.Client) transport.Transport {
 // and other custom options specific to the client.
 // If the net/http client is nil or empty, it will use a net/http client configured
 // with http.DefaultTransport.
+//
+// Credentials this client adds where the transport cannot see them are not
+// subject to the redirect stripping described on AuthMethod: a RoundTripper
+// injects after the hop is decided, and Client.Jar is consulted after
+// CheckRedirect, so a domain cookie still follows a redirect to a subdomain
+// the transport counts as another origin. Apply them in an AuthMethod instead
+// if that is not wanted. A CheckRedirect hook set on this client runs
+// alongside the transport's own, but any header it adds when a redirect
+// leaves the repository's origin is discarded the same way.
+//
+// A RoundTripper is therefore also how to authenticate to a new origin a
+// redirect has moved the repository to: match on the request URL and inject
+// the credential only for that origin, so it is not sent anywhere else. The
+// transport keeps its own CheckRedirect on the copy it makes of this client,
+// so the policy and the origin checks still apply.
+//
+// None of this applies to a RoundTripper that follows redirects itself:
+// CheckRedirect is not consulted then, so no stripping happens at all.
 func NewClientWithOptions(c *http.Client, opts *ClientOptions) transport.Transport {
 	if c == nil {
 		c = &http.Client{
@@ -150,12 +207,16 @@ func NewClientWithOptions(c *http.Client, opts *ClientOptions) transport.Transpo
 	}
 	cl := &client{
 		client: c,
+		follow: FollowInitialRedirects,
 	}

 	if opts != nil {
 		if opts.CacheMaxEntries > 0 {
 			cl.transports = lru.New(opts.CacheMaxEntries)
 		}
+		if opts.RedirectPolicy != "" {
+			cl.follow = opts.RedirectPolicy
+		}
 	}
 	return cl
 }
@@ -289,14 +350,9 @@ func newSession(c *client, ep *transport.Endpoint, auth transport.AuthMethod) (*
 			}
 		}

-		httpClient = &http.Client{
-			Transport:     transport,
-			CheckRedirect: c.client.CheckRedirect,
-			Jar:           c.client.Jar,
-			Timeout:       c.client.Timeout,
-		}
+		httpClient = c.cloneHTTPClient(transport)
 	} else {
-		httpClient = c.client
+		httpClient = c.cloneHTTPClient(c.client.Transport)
 	}

 	s := &session{
@@ -324,30 +380,446 @@ func (s *session) ApplyAuthToRequest(req *http.Request) {
 	s.auth.SetAuth(req)
 }

-func (s *session) ModifyEndpointIfRedirect(res *http.Response) {
+func (s *session) ModifyEndpointIfRedirect(res *http.Response) error {
 	if res.Request == nil {
-		return
+		return nil
+	}
+	if s.endpoint == nil {
+		return fmt.Errorf("http redirect: nil endpoint")
 	}

 	r := res.Request
 	if !strings.HasSuffix(r.URL.Path, infoRefsPath) {
-		return
+		return fmt.Errorf("http redirect: target %q does not end with %s", r.URL.Path, infoRefsPath)
+	}
+	// A scheme is case-insensitive per RFC 3986, and checkRedirect folds case
+	// when it reads the same hop, so fold here too rather than reject a
+	// spelling that check let through. url.Parse and transport.NewEndpoint
+	// both lowercase what they parse, so only a hand-built URL or Endpoint
+	// arrives uppercased. The folded form is what gets stored below, so every
+	// later request built from the endpoint carries the canonical spelling.
+	scheme := strings.ToLower(r.URL.Scheme)
+	if scheme != "http" && scheme != "https" {
+		return fmt.Errorf("http redirect: unsupported scheme %q", r.URL.Scheme)
+	}
+	// schemeUpgrade rather than an inline comparison, so the one cross-scheme
+	// change go-git permits has a single definition shared with
+	// credentialsMayFollow.
+	if !strings.EqualFold(scheme, s.endpoint.Protocol) && !schemeUpgrade(s.endpoint.Protocol, scheme) {
+		return fmt.Errorf("http redirect: changes scheme from %q to %q", s.endpoint.Protocol, r.URL.Scheme)
 	}

-	h, p, err := net.SplitHostPort(r.URL.Host)
+	host := endpointHost(r.URL.Hostname())
+	port, err := endpointPort(r.URL.Port())
 	if err != nil {
-		h = r.URL.Host
+		return err
 	}
-	if p != "" {
-		port, err := strconv.Atoi(p)
-		if err == nil {
-			s.endpoint.Port = port
+
+	// The session stores the endpoint and re-applies its credentials on every
+	// later request, so clear them once the redirect has left the origin they
+	// were issued for. This uses the same predicate as stripCredentials, so
+	// both halves share one definition of an origin.
+	//
+	// The two are deliberately asymmetric in one respect: stripCredentials is
+	// sticky over the whole chain, so an origin -> evil -> origin redirect
+	// leaves the discovery GET's later hops unauthenticated even though the
+	// chain returned home. This compares the endpoint only against the final
+	// URL, so the same round trip leaves the session authenticated. That is
+	// not a leak - the final URL's origin is the original one - but it means
+	// such a chain can make the discovery GET anonymous while the session's
+	// POSTs are authenticated, which can surface as a confusing 401.
+	if !credentialsMayFollow(endpointURL(s.endpoint), r.URL) {
+		s.endpoint.User = ""
+		s.endpoint.Password = ""
+		s.auth = nil
+	}
+
+	s.endpoint.Host = host
+	s.endpoint.Port = port
+
+	s.endpoint.Protocol = scheme
+	s.endpoint.Path = r.URL.Path[:len(r.URL.Path)-len(infoRefsPath)]
+	return nil
+}
+
+func endpointHost(host string) string {
+	if strings.Contains(host, ":") {
+		return "[" + host + "]"
+	}
+
+	return host
+}
+
+func endpointPort(port string) (int, error) {
+	if port == "" {
+		return 0, nil
+	}
+
+	parsed, err := strconv.Atoi(port)
+	if err != nil {
+		return 0, fmt.Errorf("http redirect: invalid port %q", port)
+	}
+
+	return parsed, nil
+}
+
+// schemeUpgrade reports whether the scheme transition from one URL to another
+// is the one cross-scheme change go-git permits: a plain-http origin upgrading
+// to https. It strictly improves confidentiality and is how servers steer
+// clients off cleartext.
+//
+// Permitting it at all is a deliberate deviation: curl, git and the Fetch
+// standard all count scheme as part of host identity and drop credentials on
+// the upgrade. Auth is sent pre-emptively here, so an http origin has already
+// spent its credential in cleartext on the first request and refusing the
+// upgrade would break the clone without unspending it. The host is unchanged,
+// where an on-path attacker needs a valid certificate to receive anything.
+func schemeUpgrade(from, to string) bool {
+	return strings.EqualFold(from, "http") && strings.EqualFold(to, "https")
+}
+
+// canonicalHost returns u's hostname in the form origins are compared in.
+//
+// An address literal is normalised by netip, so the many spellings of one
+// address are one origin. Two literals are the same origin exactly when netip
+// parses them to the same Addr, which is also how the WHATWG URL Standard
+// compares hosts. An IPv4-mapped literal is deliberately not unmapped onto
+// the IPv4 it dials: reaching the same endpoint is not the same authority,
+// since net/http sends the literal as written in Host and a server may route
+// the two spellings to different virtual hosts.
+//
+// netip also keeps a scope zone verbatim, which is what origin comparison
+// needs: net resolves a zone to an interface by exact name, so folding %eth0
+// onto %ETH0 would call two hosts the same origin that net dials down
+// different interfaces.
+//
+// A registered name is ASCII-lowercased. That fold is the only liberty taken;
+// every other difference in spelling is a different origin.
+//
+// A trailing root dot is one such difference and is kept, for the same reason
+// as the IPv4-mapped literal: curl and the WHATWG URL Standard both hold
+// "example.com." and "example.com" to be distinct hosts, and although
+// crypto/tls and crypto/x509 fold the dot when they authenticate the peer,
+// net/http sends the name as written in Host.
+//
+// The fold is deliberately ASCII-only. strings.ToLower and strings.EqualFold
+// apply Unicode case mapping, which folds U+03C2 onto U+03C3 and so would
+// call two hosts the same origin when they resolve to different servers. An
+// ASCII-only fold cannot merge two names DNS keeps apart.
+//
+// No IDNA mapping is applied either, so a unicode hostname is a different
+// origin from the punycode encoding of it, and from another Unicode case of
+// itself, even though all three reach the same server. Mapping through
+// golang.org/x/net/idna would join them, but it can only widen this equality,
+// never narrow it, so leaving it out can cost a credential across such a
+// redirect and cannot forward one. Against that cost, go-git pins x/net while
+// net/http uses the copy vendored into the toolchain: the two are versioned
+// separately, so a release that moves the Unicode tables under one and not
+// the other would have this merge origins net/http still dials apart. That is
+// the failure this comparison exists to prevent, and comparing bytes has no
+// such mode.
+func canonicalHost(u *url.URL) string {
+	host := u.Hostname()
+	if addr, err := netip.ParseAddr(host); err == nil {
+		return addr.String()
+	}
+	b := []byte(host)
+	for i := range b {
+		if b[i] >= 'A' && b[i] <= 'Z' {
+			b[i] += 'a' - 'A'
 		}
 	}
-	s.endpoint.Host = h
+	return string(b)
+}

-	s.endpoint.Protocol = r.URL.Scheme
-	s.endpoint.Path = r.URL.Path[:len(r.URL.Path)-len(infoRefsPath)]
+// effectivePort returns u's port as the connection will use it: the scheme's
+// well-known port when the URL does not spell one out, and without leading
+// zeroes, so "https://x", "https://x:443" and "https://x:0443" all agree.
+func effectivePort(u *url.URL) string {
+	port := u.Port()
+	if port == "" {
+		switch strings.ToLower(u.Scheme) {
+		case "http":
+			return "80"
+		case "https":
+			return "443"
+		default:
+			return ""
+		}
+	}
+	if trimmed := strings.TrimLeft(port, "0"); trimmed != "" {
+		return trimmed
+	}
+	return "0"
+}
+
+// credentialsMayFollow reports whether credentials issued for one URL may be
+// sent to another.
+//
+// The relation is deliberately asymmetric: scheme, host and effective port
+// must all match, except that a plain http origin may upgrade to https on the
+// same host (see schemeUpgrade). That exception is confined to the two
+// default ports: 80 to 443 is the upgrade servers actually steer clients
+// through, whereas a non-default port carries no such convention, so
+// http://host:8080 to https://host:8443 is a move to another origin like any
+// other port change.
+//
+// Host matching is exact. Unlike Go's http.Client, which forwards credentials
+// from a host to any subdomain of it, a subdomain is a different origin here —
+// matching canonical git and libcurl.
+func credentialsMayFollow(from, to *url.URL) bool {
+	if canonicalHost(from) != canonicalHost(to) {
+		return false
+	}
+	if strings.EqualFold(from.Scheme, to.Scheme) {
+		return effectivePort(from) == effectivePort(to)
+	}
+	return schemeUpgrade(from.Scheme, to.Scheme) &&
+		effectivePort(from) == "80" && effectivePort(to) == "443"
+}
+
+// endpointURL renders an Endpoint's origin as a URL, so that the session's
+// credential clearing and the per-hop stripping share one definition of an
+// origin and cannot drift apart.
+func endpointURL(ep *transport.Endpoint) *url.URL {
+	host := strings.Trim(ep.Host, "[]")
+	if ep.Port != 0 {
+		host = net.JoinHostPort(host, strconv.Itoa(ep.Port))
+	} else if strings.Contains(host, ":") {
+		host = "[" + host + "]"
+	}
+	return &url.URL{Scheme: ep.Protocol, Host: host}
+}
+
+func (c *client) cloneHTTPClient(transport http.RoundTripper) *http.Client {
+	return &http.Client{
+		Transport:     transport,
+		CheckRedirect: wrapCheckRedirect(c.follow, c.client.CheckRedirect),
+		Jar:           c.client.Jar,
+		Timeout:       c.client.Timeout,
+	}
+}
+
+func wrapCheckRedirect(policy RedirectPolicy, next func(*http.Request, []*http.Request) error) func(*http.Request, []*http.Request) error {
+	return func(req *http.Request, via []*http.Request) error {
+		if err := checkRedirect(req, via, policy); err != nil {
+			return err
+		}
+		// Strip before the caller's hook so it observes what will actually
+		// be sent, and again afterwards so a hook of the common "preserve
+		// my headers across redirects" shape - which copies from via[0],
+		// the original unsanitized request - cannot reinstate them.
+		// Carrying credentials across an origin boundary is deliberately
+		// unsupported.
+		stripCredentials(req, via)
+		if next != nil {
+			if err := next(req, via); err != nil {
+				return err
+			}
+		}
+		stripCredentials(req, via)
+		return nil
+	}
+}
+
+// safeHeaders lists the headers go-git sets itself, none of which can carry a
+// caller credential. stripCredentials keeps only these when a redirect leaves
+// the credential's origin. Adding a name here makes it forwardable across an
+// origin boundary - do not add anything a caller can put a secret in.
+//
+// This narrows rather than eliminates the exposure: an AuthMethod that writes
+// a credential into one of these names directly - for example
+// Header.Set("User-Agent", "token "+secret) - still survives a cross-origin
+// redirect. Such a value is also sent to the origin and to any proxy in path,
+// so it should not be placed there whether or not a redirect follows.
+var safeHeaders = map[string]struct{}{
+	"User-Agent":     {},
+	"Host":           {},
+	"Accept":         {},
+	"Content-Type":   {},
+	"Content-Length": {},
+}
+
+func filterHeaders(h http.Header) http.Header {
+	filtered := make(http.Header)
+	for key, values := range h {
+		if _, ok := safeHeaders[http.CanonicalHeaderKey(key)]; ok {
+			filtered[key] = values
+		}
+	}
+	return filtered
+}
+
+// stripCredentials removes credentials from req once the redirect chain has
+// left the origin of the original, credential-bearing request.
+//
+// CheckRedirect is the only hook that runs while a redirected request's
+// headers are still mutable: http.Client.Do performs the entire chain
+// internally, so anything the transport does after Do returns - including
+// ModifyEndpointIfRedirect - is too late for the hops themselves.
+//
+// Two subtleties:
+//
+//   - net/http rebuilds every redirect request from the original request's
+//     headers before calling this, so a header removed at one hop reappears
+//     at the next. The decision is therefore recomputed per hop.
+//   - The decision is sticky: once the chain has left the origin, credentials
+//     stay gone even if a later hop returns to it. Stickiness is derived from
+//     via rather than stored, because this closure is shared across a
+//     session's requests.
+//
+// Stripping keeps only the headers go-git sets itself (safeHeaders). An
+// allowlist is used rather than a list of credential header names because
+// caller credentials arrive under names that cannot be enumerated -
+// PRIVATE-TOKEN, X-Api-Key, gateway headers - which is exactly what
+// net/http's fixed list of sensitive header names gets wrong. It is also
+// immune to header-name canonicalisation: an AuthMethod that writes a raw map
+// key is still removed.
+func stripCredentials(req *http.Request, via []*http.Request) {
+	if len(via) == 0 {
+		return
+	}
+	// net/http sets a URL on every request it builds, and req.URL is non-nil
+	// by construction: checkRedirect dereferences req.URL.Scheme on each path
+	// that returns nil, so it runs first or not at all. This nil check and
+	// the two in crossedOrigin are defensive, against a synthetic caller.
+	// Each treats a URL it cannot read as an origin crossing; removing one
+	// panics in canonicalHost rather than leaking.
+	if origin := via[0].URL; origin != nil && !crossedOrigin(origin, req, via) {
+		return
+	}
+	req.Header = filterHeaders(req.Header)
+	if req.URL != nil {
+		req.URL.User = nil
+	}
+}
+
+// crossedOrigin reports whether any hop so far, including the pending one, has
+// left origin.
+func crossedOrigin(origin *url.URL, req *http.Request, via []*http.Request) bool {
+	if req.URL == nil || !credentialsMayFollow(origin, req.URL) {
+		return true
+	}
+	for _, prev := range via[1:] {
+		if prev.URL == nil || !credentialsMayFollow(origin, prev.URL) {
+			return true
+		}
+	}
+	return false
+}
+
+// redactedURL returns the string form of u with the userinfo password
+// replaced, for use in error messages. (*url.URL).String() renders the
+// password verbatim, and request URLs are built from the endpoint, which
+// carries whatever credentials the caller put in the clone URL.
+func redactedURL(u *url.URL) string {
+	if u == nil {
+		return ""
+	}
+	if u.User == nil {
+		return u.String()
+	}
+	if _, hasPassword := u.User.Password(); !hasPassword {
+		return u.String()
+	}
+	redacted := *u
+	redacted.User = url.UserPassword(u.User.Username(), "REDACTED")
+	return redacted.String()
+}
+
+// redactedRawURL is redactedURL for a string that may not parse. Request URLs
+// are assembled from Endpoint.String(), which re-emits Endpoint.Path raw, so a
+// path holding a stray percent produces a string url.Parse rejects. url.Parse
+// reports the input verbatim and applies no redaction of its own; only
+// http.Client strips a password, and only from errors it raises itself.
+func redactedRawURL(raw string) string {
+	i := strings.Index(raw, "://")
+	if i < 0 {
+		return raw
+	}
+	authority := raw[i+3:]
+	if end := strings.IndexByte(authority, '/'); end >= 0 {
+		authority = authority[:end]
+	}
+	at := strings.LastIndexByte(authority, '@')
+	if at < 0 {
+		return raw
+	}
+	colon := strings.IndexByte(authority[:at], ':')
+	if colon < 0 {
+		// Username only, left alone, as redactedURL leaves it.
+		return raw
+	}
+	return raw[:i+3+colon+1] + "REDACTED" + raw[i+3+at:]
+}
+
+// newRequest wraps http.NewRequest so that a URL it cannot parse does not
+// reach the caller with the endpoint's credentials still in it.
+func newRequest(method, rawURL string, body io.Reader) (*http.Request, error) {
+	req, err := http.NewRequest(method, rawURL, body)
+	if err != nil {
+		var uerr *url.Error
+		if errors.As(err, &uerr) {
+			uerr.URL = redactedRawURL(uerr.URL)
+		}
+		return nil, err
+	}
+	return req, nil
+}
+
+func checkRedirect(req *http.Request, via []*http.Request, policy RedirectPolicy) error {
+	// CheckRedirect is the only hook that runs before the next hop leaves
+	// the client. ModifyEndpointIfRedirect inspects the chain after
+	// client.Do has followed all of it, so a hop rejected there has already
+	// carried the request headers to its server.
+	//
+	// The wording matches the message ModifyEndpointIfRedirect produces for
+	// the same hop, which this check reaches first.
+	if len(via) != 0 {
+		// A hop whose scheme cannot be read cannot be shown not to have been
+		// https, so it is assumed to have been, and a cleartext target is
+		// rejected. Skipping the comparison instead would let an
+		// undeterminable hop turn the check off, which is the wrong default
+		// for a credential control; crossedOrigin fails closed the same way.
+		// An empty scheme is as unreadable as a nil URL, so both take the
+		// assumed-https default.
+		//
+		// The comparisons fold case because a scheme is case-insensitive per
+		// RFC 3986. net/url lowercases what it parses, so only a hand-built
+		// URL reaches here uppercased - the same synthetic caller the nil
+		// checks guard against - and for that caller "HTTPS" to "http" is
+		// still a downgrade.
+		prevScheme := "https"
+		if prev := via[len(via)-1]; prev.URL != nil && prev.URL.Scheme != "" {
+			prevScheme = prev.URL.Scheme
+		}
+		if strings.EqualFold(prevScheme, "https") && strings.EqualFold(req.URL.Scheme, "http") {
+			return fmt.Errorf("http redirect: changes scheme from %q to %q: %s",
+				prevScheme, req.URL.Scheme, redactedURL(req.URL))
+		}
+	}
+
+	switch policy {
+	case FollowRedirects:
+	case NoFollowRedirects:
+		return fmt.Errorf("http redirect: redirects disabled to %s", redactedURL(req.URL))
+	case "", FollowInitialRedirects:
+		if !isInitialRequest(req) {
+			return fmt.Errorf("http redirect: redirect on non-initial request to %s", redactedURL(req.URL))
+		}
+	default:
+		return fmt.Errorf("http redirect: invalid redirect policy %q", policy)
+	}
+	// Folded for the same reason as the guard above: a scheme is
+	// case-insensitive per RFC 3986, so a spelling the downgrade check read
+	// as https must not be rejected here as a scheme go-git cannot speak.
+	if !strings.EqualFold(req.URL.Scheme, "http") && !strings.EqualFold(req.URL.Scheme, "https") {
+		return fmt.Errorf("http redirect: unsupported scheme %q", req.URL.Scheme)
+	}
+	if len(via) >= 10 {
+		return fmt.Errorf("http redirect: too many redirects")
+	}
+	return nil
 }

 func (*session) Close() error {
@@ -355,6 +827,17 @@ func (*session) Close() error {
 }

 // AuthMethod is concrete implementation of common.AuthMethod for HTTP services
+//
+// Headers SetAuth adds are dropped when a redirect leaves the repository's
+// origin: only the headers the transport sets itself survive that boundary.
+// This applies to non-credential headers too, so an implementation that adds a
+// trace or tenant header loses it on such a hop.
+//
+// That filter matches header names, not values. An implementation that writes
+// a credential into a name the transport also uses - User-Agent, Host, Accept,
+// Content-Type, Content-Length - has that value carried across the boundary
+// with the name. Such a credential is also sent to the origin and to any proxy
+// in path, so it should not be placed there whether or not a redirect follows.
 type AuthMethod interface {
 	transport.AuthMethod
 	SetAuth(r *http.Request)
@@ -472,6 +955,6 @@ func (e *Err) StatusCode() int {

 func (e *Err) Error() string {
 	return fmt.Sprintf("unexpected requesting %q status code: %d",
-		e.Response.Request.URL, e.Response.StatusCode,
+		redactedURL(e.Response.Request.URL), e.Response.StatusCode,
 	)
 }
@@ -88,7 +88,7 @@ func (s *rpSession) doRequest(
 		body = content
 	}

-	req, err := http.NewRequest(method, url, body)
+	req, err := newRequest(method, url, body)
 	if err != nil {
 		return nil, plumbing.NewPermanentError(err)
 	}
@@ -86,7 +86,7 @@ func (s *upSession) doRequest(
 		body = content
 	}

-	req, err := http.NewRequest(method, url, body)
+	req, err := newRequest(method, url, body)
 	if err != nil {
 		return nil, plumbing.NewPermanentError(err)
 	}
@@ -252,7 +252,39 @@ func (c *command) setAuthFromEndpoint() error {
 }

 func endpointToCommand(cmd string, ep *transport.Endpoint) string {
-	return fmt.Sprintf("%s '%s'", cmd, ep.Path)
+	var b strings.Builder
+	b.WriteString(cmd)
+	b.WriteByte(' ')
+	writeShellQuote(&b, ep.Path)
+	return b.String()
+}
+
+// writeShellQuote writes s to b, wrapped in single quotes with
+// embedded single quotes and exclamation marks escaped using the
+// POSIX close-escape-reopen idiom:
+//
+//	' becomes '\''
+//	! becomes '\!'
+//
+// It is a direct port of canonical Git's sq_quote_buf (quote.c).
+// The bang escape keeps the result safe when re-evaluated under
+// csh-derived shells that perform history expansion. The output is
+// safe to pass as a single argument through any POSIX shell and
+// round-trips through git-shell's sq_dequote_to_argv.
+func writeShellQuote(b *strings.Builder, s string) {
+	b.Grow(len(s) + 2)
+	b.WriteByte('\'')
+	for i := 0; i < len(s); i++ {
+		c := s[i]
+		if c == '\'' || c == '!' {
+			b.WriteString(`'\`)
+			b.WriteByte(c)
+			b.WriteByte('\'')
+			continue
+		}
+		b.WriteByte(c)
+	}
+	b.WriteByte('\'')
 }

 func overrideConfig(overrides *ssh.ClientConfig, c *ssh.ClientConfig) {
@@ -433,6 +433,7 @@ func dotGitCommonDirectory(fs billy.Filesystem) (commonDir billy.Filesystem, err
 	if err != nil {
 		return nil, err
 	}
+	defer ioutil.CheckClose(f, &err)

 	b, err := io.ReadAll(f)
 	if err != nil {
@@ -1530,7 +1531,18 @@ func (r *Repository) Worktree() (*Worktree, error) {
 		return nil, ErrIsBareRepository
 	}

-	return &Worktree{r: r, Filesystem: r.wt}, nil
+	protectNTFS := defaultProtectNTFS()
+	protectHFS := defaultProtectHFS()
+	if cfg, err := r.Config(); err == nil {
+		if cfg.Core.ProtectNTFS.IsSet() {
+			protectNTFS = cfg.Core.ProtectNTFS.IsTrue()
+		}
+		if cfg.Core.ProtectHFS.IsSet() {
+			protectHFS = cfg.Core.ProtectHFS.IsTrue()
+		}
+	}
+
+	return &Worktree{r: r, Filesystem: newWorktreeFilesystem(r.wt, protectNTFS, protectHFS)}, nil
 }

 func expand_ref(s storer.ReferenceStorer, ref plumbing.ReferenceName) (*plumbing.Reference, error) {
@@ -16,6 +16,7 @@ import (
 	"strings"
 	"time"

+	"github.com/go-git/go-git/v5/internal/pathutil"
 	"github.com/go-git/go-git/v5/plumbing"
 	"github.com/go-git/go-git/v5/plumbing/hash"
 	"github.com/go-git/go-git/v5/storage"
@@ -75,8 +76,56 @@ var (
 	// ErrEmptyRefFile is returned when a reference file is attempted to be read,
 	// but the file is empty
 	ErrEmptyRefFile = errors.New("ref file is empty")
+	// ErrModuleNameEscape is returned when a submodule name would
+	// resolve outside the modules/ subtree, mirroring canonical Git's
+	// "ignoring suspicious submodule name" defence.
+	ErrModuleNameEscape = errors.New("submodule name escapes modules/ directory")
+	// ErrReferenceNameEscape is returned when a reference name would
+	// resolve outside its reference sub-tree once turned into a path
+	// under the .git directory (e.g. a name with a ".." component).
+	ErrReferenceNameEscape = errors.New("reference name escapes the reference storage")
 )

+// isPathSep reports whether r is a path separator in reference names.
+// It treats both '/' and '\\' as separators to harden against cross-OS paths.
+func isPathSep(r rune) bool { return r == '/' || r == '\\' }
+
+// validReferenceName rejects reference names that cannot be safely turned into
+// a path under the .git directory. A loose reference is stored verbatim at
+// ".git/<name>", so a crafted name — for instance one advertised by a malicious
+// remote — could climb out of its reference sub-tree and read, overwrite, or
+// delete unrelated metadata such as .git/config.
+//
+// The storage-safety gate is plumbing.ReferenceName.IsSafe, mirroring Git's
+// refname_is_safe: a name must be under refs/ without escaping it, or be a
+// [A-Z_] pseudo-ref. This alone rejects absolute, drive-prefixed, escaping and
+// single-level metadata names. On top of it, this adds filesystem-specific
+// hardening that IsSafe's literal check does not cover: control characters, and
+// components a case-insensitive/NTFS/HFS+ filesystem would fold back to "." or
+// ".." (trailing dots/spaces, Alternate Data Streams, ignorable Unicode code
+// points), delegated to pathutil.IsHFSDot and pathutil.IsNTFSDot with "." as
+// the needle — as validSubmoduleName does — and run regardless of host OS.
+func validReferenceName(name plumbing.ReferenceName) error {
+	if !name.IsSafe() {
+		return fmt.Errorf("%w: %q is not under refs/ nor a valid pseudo-ref", ErrReferenceNameEscape, string(name))
+	}
+
+	s := string(name)
+	for i := 0; i < len(s); i++ {
+		if s[i] < 0x20 || s[i] == 0x7f {
+			return fmt.Errorf("%w: %q", ErrReferenceNameEscape, s)
+		}
+	}
+	for _, part := range strings.FieldsFunc(s, isPathSep) {
+		// IsNTFSDot/IsHFSDot with a "." needle match ".." and its disguises
+		// but not a bare ".", so reject that component explicitly too.
+		if part == "." || pathutil.IsHFSDot(part, ".") || pathutil.IsNTFSDot(part, ".", "") {
+			return fmt.Errorf("%w: %q", ErrReferenceNameEscape, s)
+		}
+	}
+	return nil
+}
+
 // Options holds configuration for the storage.
 type Options struct {
 	// ExclusiveAccess means that the filesystem is not modified externally
@@ -702,6 +751,10 @@ func (d *DotGit) checkReferenceAndTruncate(f billy.File, old *plumbing.Reference
 }

 func (d *DotGit) SetRef(r, old *plumbing.Reference) error {
+	if err := validReferenceName(r.Name()); err != nil {
+		return err
+	}
+
 	var content string
 	switch r.Type() {
 	case plumbing.SymbolicReference:
@@ -737,6 +790,10 @@ func (d *DotGit) Refs() ([]*plumbing.Reference, error) {

 // Ref returns the reference for a given reference name.
 func (d *DotGit) Ref(name plumbing.ReferenceName) (*plumbing.Reference, error) {
+	if err := validReferenceName(name); err != nil {
+		return nil, err
+	}
+
 	ref, err := d.readReferenceFile(".", name.String())
 	if err == nil {
 		return ref, nil
@@ -800,6 +857,10 @@ func (d *DotGit) packedRef(name plumbing.ReferenceName) (*plumbing.Reference, er

 // RemoveRef removes a reference by name.
 func (d *DotGit) RemoveRef(name plumbing.ReferenceName) error {
+	if err := validReferenceName(name); err != nil {
+		return err
+	}
+
 	path := d.fs.Join(".", name.String())
 	_, err := d.fs.Stat(path)
 	if err == nil {
@@ -1127,9 +1188,20 @@ func (d *DotGit) PackRefs() (err error) {
 	return nil
 }

-// Module return a billy.Filesystem pointing to the module folder
+// Module returns a billy.Filesystem pointing to the module folder.
+//
+// As a defence in depth against submodule name path traversal,
+// refuse names whose joined path leaves the modules/ subtree once
+// cleaned. The config-layer parser also validates submodule names,
+// but Module may be reached from any caller that constructs a
+// Submodule struct programmatically and so bypasses the parser.
 func (d *DotGit) Module(name string) (billy.Filesystem, error) {
-	return d.fs.Chroot(d.fs.Join(modulePath, name))
+	p := d.fs.Join(modulePath, name)
+	cleaned := path.Clean(filepath.ToSlash(p))
+	if cleaned != modulePath && !strings.HasPrefix(cleaned, modulePath+"/") {
+		return nil, ErrModuleNameEscape
+	}
+	return d.fs.Chroot(p)
 }

 func (d *DotGit) AddAlternate(remote string) error {
@@ -6,9 +6,12 @@ import (
 	"errors"
 	"fmt"
 	"path"
+	"path/filepath"

 	"github.com/go-git/go-billy/v5"
 	"github.com/go-git/go-git/v5/config"
+	"github.com/go-git/go-git/v5/internal/pathutil"
+	giturl "github.com/go-git/go-git/v5/internal/url"
 	"github.com/go-git/go-git/v5/plumbing"
 	"github.com/go-git/go-git/v5/plumbing/format/index"
 	"github.com/go-git/go-git/v5/plumbing/transport"
@@ -119,6 +122,16 @@ func (s *Submodule) Repository() (*Repository, error) {
 		exists = true
 	}

+	// s.c.Path is sourced from the worktree's .gitmodules and is
+	// therefore tree-controlled. Apply the strict tree-path validator
+	// before chroot — the wrapper's tolerant validPath would let a
+	// final-position .git component through (e.g. "submodule/.git"),
+	// which a malicious .gitmodules could use to chroot the submodule
+	// worktree into the repository's actual .git directory.
+	if err := pathutil.ValidTreePath(s.c.Path); err != nil {
+		return nil, err
+	}
+
 	var worktree billy.Filesystem
 	if worktree, err = s.w.Filesystem.Chroot(s.c.Path); err != nil {
 		return nil, err
@@ -138,18 +151,25 @@ func (s *Submodule) Repository() (*Repository, error) {
 		return nil, err
 	}

-	if !path.IsAbs(moduleEndpoint.Path) && moduleEndpoint.Protocol == "file" {
-		remotes, err := s.w.r.Remotes()
+	// A relative submodule URL such as "../X.git" must resolve against
+	// the parent repository's remote URL, not against the process CWD.
+	// Detect relativity from the raw configured URL because
+	// transport.NewEndpoint normalizes local paths to absolute form via
+	// filepath.Abs, which would otherwise mask the relative form here.
+	if giturl.IsLocalEndpoint(s.c.URL) &&
+		!path.IsAbs(s.c.URL) && !filepath.IsAbs(s.c.URL) {
+
+		base, err := defaultRemote(s.w.r)
+		if err != nil {
+			return nil, fmt.Errorf("resolving relative submodule URL: %w", err)
+		}
+
+		rootEndpoint, err := transport.NewEndpoint(base.URLs[0])
 		if err != nil {
 			return nil, err
 		}

-		rootEndpoint, err := transport.NewEndpoint(remotes[0].c.URLs[0])
-		if err != nil {
-			return nil, err
-		}
-
-		rootEndpoint.Path = path.Join(rootEndpoint.Path, moduleEndpoint.Path)
+		rootEndpoint.Path = path.Join(rootEndpoint.Path, s.c.URL)
 		*moduleEndpoint = *rootEndpoint
 	}

@@ -161,6 +181,52 @@ func (s *Submodule) Repository() (*Repository, error) {
 	return r, err
 }

+// defaultRemote returns the remote that relative submodule URLs are
+// resolved against, mirroring canonical Git's repo_default_remote
+// (remote.c) and resolve_relative_url (builtin/submodule--helper.c):
+//
+//  1. if HEAD is on a branch with branch.<name>.remote configured,
+//     use that remote;
+//  2. else if exactly one remote is configured, use it;
+//  3. otherwise fall back to DefaultRemoteName ("origin").
+//
+// Each rule falls through unconditionally: a branch lookup that
+// finds the branch but with an empty Remote does not short-circuit
+// rule (2). Returns an error when the chosen remote is not configured.
+func defaultRemote(r *Repository) (*config.RemoteConfig, error) {
+	cfg, err := r.Config()
+	if err != nil {
+		return nil, err
+	}
+
+	if ref, err := r.Reference(plumbing.HEAD, false); err == nil &&
+		ref.Type() == plumbing.SymbolicReference &&
+		ref.Target().IsBranch() {
+		if b, ok := cfg.Branches[ref.Target().Short()]; ok && b.Remote != "" {
+			return lookupRemote(cfg, b.Remote)
+		}
+	}
+
+	if len(cfg.Remotes) == 1 {
+		for name := range cfg.Remotes {
+			return lookupRemote(cfg, name)
+		}
+	}
+
+	return lookupRemote(cfg, DefaultRemoteName)
+}
+
+func lookupRemote(cfg *config.Config, name string) (*config.RemoteConfig, error) {
+	rc, ok := cfg.Remotes[name]
+	if !ok {
+		return nil, fmt.Errorf("remote %q not found", name)
+	}
+	if len(rc.URLs) == 0 {
+		return nil, fmt.Errorf("remote %q has no configured URL", name)
+	}
+	return rc, nil
+}
+
 // Update the registered submodule to match what the superproject expects, the
 // submodule should be initialized first calling the Init method or setting in
 // the options SubmoduleUpdateOptions.Init equals true
@@ -5,11 +5,18 @@ package binary
 import (
 	"bufio"
 	"encoding/binary"
+	"errors"
 	"io"
+	"math"

 	"github.com/go-git/go-git/v5/plumbing"
 )

+// ErrIntegerOverflow is returned when a Git-format variable-width integer
+// would not fit into an int64 because the input declares more continuation
+// bytes than the type can hold.
+var ErrIntegerOverflow = errors.New("variable-width integer overflow")
+
 // Read reads structured binary data from r into data. Bytes are read and
 // decoded in BigEndian order
 // https://golang.org/pkg/encoding/binary/#Read
@@ -92,6 +99,14 @@ func ReadVariableWidthInt(r io.Reader) (int64, error) {

 	var v = int64(c & maskLength)
 	for c&maskContinue > 0 {
+		// Reject input that, after the v++ and shift below, would
+		// not fit in an int64. With v < (MaxInt64-127)>>7, the
+		// post-increment v is at most (MaxInt64-127)>>7 and the
+		// final (v << 7) + (c & 0x7F) stays within int64.
+		if v >= (math.MaxInt64-int64(maskLength))>>lengthBits {
+			return 0, ErrIntegerOverflow
+		}
+
 		v++
 		if err := Read(r, &c); err != nil {
 			return 0, err
@@ -7,7 +7,6 @@ import (
 	"io"
 	"os"
 	"path/filepath"
-	"runtime"
 	"strings"

 	"github.com/go-git/go-billy/v5"
@@ -458,10 +457,6 @@ func (w *Worktree) resetWorktree(t *object.Tree, files []string) error {

 	filesMap := buildFilePathMap(files)
 	for _, ch := range changes {
-		if err := w.validChange(ch); err != nil {
-			return err
-		}
-
 		if len(files) > 0 {
 			file := ""
 			if ch.From != nil {
@@ -489,108 +484,6 @@ func (w *Worktree) resetWorktree(t *object.Tree, files []string) error {
 	return w.r.Storer.SetIndex(idx)
 }

-// worktreeDeny is a list of paths that are not allowed
-// to be used when resetting the worktree.
-var worktreeDeny = map[string]struct{}{
-	// .git
-	GitDirName: {},
-
-	// For other historical reasons, file names that do not conform to the 8.3
-	// format (up to eight characters for the basename, three for the file
-	// extension, certain characters not allowed such as `+`, etc) are associated
-	// with a so-called "short name", at least on the `C:` drive by default.
-	// Which means that `git~1/` is a valid way to refer to `.git/`.
-	"git~1": {},
-}
-
-// validPath checks whether paths are valid.
-// The rules around invalid paths could differ from upstream based on how
-// filesystems are managed within go-git, but they are largely the same.
-//
-// For upstream rules:
-// https://github.com/git/git/blob/564d0252ca632e0264ed670534a51d18a689ef5d/read-cache.c#L946
-// https://github.com/git/git/blob/564d0252ca632e0264ed670534a51d18a689ef5d/path.c#L1383
-func validPath(paths ...string) error {
-	for _, p := range paths {
-		parts := strings.FieldsFunc(p, func(r rune) bool { return (r == '\\' || r == '/') })
-		if len(parts) == 0 {
-			return fmt.Errorf("invalid path: %q", p)
-		}
-
-		if _, denied := worktreeDeny[strings.ToLower(parts[0])]; denied {
-			return fmt.Errorf("invalid path prefix: %q", p)
-		}
-
-		if runtime.GOOS == "windows" {
-			// Volume names are not supported, in both formats: \\ and <DRIVE_LETTER>:.
-			if vol := filepath.VolumeName(p); vol != "" {
-				return fmt.Errorf("invalid path: %q", p)
-			}
-
-			if !windowsValidPath(parts[0]) {
-				return fmt.Errorf("invalid path: %q", p)
-			}
-		}
-
-		for _, part := range parts {
-			if part == ".." {
-				return fmt.Errorf("invalid path %q: cannot use '..'", p)
-			}
-		}
-	}
-	return nil
-}
-
-// windowsPathReplacer defines the chars that need to be replaced
-// as part of windowsValidPath.
-var windowsPathReplacer *strings.Replacer
-
-func init() {
-	windowsPathReplacer = strings.NewReplacer(" ", "", ".", "")
-}
-
-func windowsValidPath(part string) bool {
-	if len(part) > 3 && strings.EqualFold(part[:4], GitDirName) {
-		// For historical reasons, file names that end in spaces or periods are
-		// automatically trimmed. Therefore, `.git . . ./` is a valid way to refer
-		// to `.git/`.
-		if windowsPathReplacer.Replace(part[4:]) == "" {
-			return false
-		}
-
-		// For yet other historical reasons, NTFS supports so-called "Alternate Data
-		// Streams", i.e. metadata associated with a given file, referred to via
-		// `<filename>:<stream-name>:<stream-type>`. There exists a default stream
-		// type for directories, allowing `.git/` to be accessed via
-		// `.git::$INDEX_ALLOCATION/`.
-		//
-		// For performance reasons, _all_ Alternate Data Streams of `.git/` are
-		// forbidden, not just `::$INDEX_ALLOCATION`.
-		if len(part) > 4 && part[4:5] == ":" {
-			return false
-		}
-	}
-	return true
-}
-
-func (w *Worktree) validChange(ch merkletrie.Change) error {
-	action, err := ch.Action()
-	if err != nil {
-		return nil
-	}
-
-	switch action {
-	case merkletrie.Delete:
-		return validPath(ch.From.String())
-	case merkletrie.Insert:
-		return validPath(ch.To.String())
-	case merkletrie.Modify:
-		return validPath(ch.From.String(), ch.To.String())
-	}
-
-	return nil
-}
-
 func (w *Worktree) checkoutChange(ch merkletrie.Change, t *object.Tree, idx *indexBuilder) error {
 	a, err := ch.Action()
 	if err != nil {
@@ -690,6 +583,10 @@ func (w *Worktree) checkoutChangeSubmodule(name string,
 			return err
 		}

+		if err := w.clearBlockingSymlinks(name); err != nil {
+			return err
+		}
+
 		if err := w.Filesystem.MkdirAll(name, mode); err != nil {
 			return err
 		}
@@ -733,7 +630,70 @@ func (w *Worktree) checkoutChangeRegularFile(name string,
 	return nil
 }

+// clearBlockingSymlinks removes a symlink that is in the way of
+// materialising name, so the checkout writes a real entry in its place
+// instead of following the link out of the worktree. Two cases:
+//
+//   - a leading directory component that is a symlink (e.g. "s" while
+//     writing "s/config", where "s" links to ".git"): OpenFile/MkdirAll
+//     would traverse it, so the write would land under the link's target.
+//   - the final component itself being a symlink (e.g. writing "s" while
+//     "s" links to ".git/config"): OpenFile with O_TRUNC, or Symlink,
+//     would follow/replace through it and clobber the target.
+//
+// A symlink can never be a legitimate parent of, or the destination for,
+// a tracked entry, so removing it is always correct. This mirrors upstream
+// Git's forced checkout, which unlinks a blocking symlink in the leading
+// path (create_directories) and unlinks an existing entry before
+// write_entry.
+// https://github.com/git/git/blob/v2.54.0/entry.c#L50
+func (w *Worktree) clearBlockingSymlinks(name string) error {
+	var dirs []string
+	for dir := filepath.Dir(name); dir != "." && dir != "" && dir != string(filepath.Separator); dir = filepath.Dir(dir) {
+		dirs = append(dirs, dir)
+	}
+	// Leading components, shallowest-first: removing the shallowest symlink
+	// invalidates every component beneath it, so a single removal is enough.
+	for i := len(dirs) - 1; i >= 0; i-- {
+		fi, err := w.Filesystem.Lstat(dirs[i])
+		if err != nil {
+			// A missing component is created as a real directory by the
+			// checkout. Any other error means we cannot tell whether it is
+			// a symlink, so surface it instead of leaving a blocking link in
+			// place and failing later in a harder-to-diagnose way.
+			if os.IsNotExist(err) {
+				continue
+			}
+			return err
+		}
+		if fi.Mode()&os.ModeSymlink != 0 {
+			return w.Filesystem.Remove(dirs[i])
+		}
+	}
+	// Final component: an existing symlink here would be followed by the
+	// subsequent OpenFile/Symlink/MkdirAll, so replace it.
+	fi, err := w.Filesystem.Lstat(name)
+	if err != nil {
+		if os.IsNotExist(err) {
+			return nil
+		}
+		return err
+	}
+	if fi.Mode()&os.ModeSymlink != 0 {
+		return w.Filesystem.Remove(name)
+	}
+	return nil
+}
+
 func (w *Worktree) checkoutFile(f *object.File) (err error) {
+	// checkoutFile is the materialisation boundary for tracked entries.
+	// Remove any blocking symlink first so the subsequent OpenFile or
+	// Symlink call writes the entry itself instead of following a planted
+	// final-component link in the underlying filesystem.
+	if err := w.clearBlockingSymlinks(f.Name); err != nil {
+		return err
+	}
+
 	mode, err := f.Mode.ToOSFileMode()
 	if err != nil {
 		return
@@ -763,10 +723,10 @@ func (w *Worktree) checkoutFile(f *object.File) (err error) {
 }

 func (w *Worktree) checkoutFileSymlink(f *object.File) (err error) {
-	// https://github.com/git/git/commit/10ecfa76491e4923988337b2e2243b05376b40de
-	if strings.EqualFold(f.Name, gitmodulesFile) {
-		return ErrGitModulesSymlink
-	}
+	// .gitmodules symlink rejection (and its NTFS / HFS variants) is
+	// enforced by the worktreeFilesystem wrapper's Symlink method via
+	// validSymlinkName. See https://github.com/git/git/commit/10ecfa7
+	// for the upstream rationale.

 	from, err := f.Reader()
 	if err != nil {
@@ -0,0 +1,349 @@
+package git
+
+import (
+	"errors"
+	"fmt"
+	"os"
+	"path/filepath"
+	"runtime"
+	"strings"
+
+	"github.com/go-git/go-billy/v5"
+
+	"github.com/go-git/go-git/v5/internal/pathutil"
+)
+
+// defaultProtectHFS returns the default value for core.protectHFS
+// when not explicitly configured. Matches upstream Git's
+// PROTECT_HFS_DEFAULT[1], which the Makefile sets to 1 on Darwin
+// and leaves at 0 on every other platform.
+//
+// [1]: https://github.com/git/git/blob/v2.54.0/config.mak.uname#L146
+func defaultProtectHFS() bool {
+	return runtime.GOOS == "darwin"
+}
+
+// defaultProtectNTFS returns the default value for core.protectNTFS
+// when not explicitly configured. Matches upstream Git's
+// PROTECT_NTFS_DEFAULT, which has been 1 on every platform since
+// 9102f958ee5 (CVE-2019-1353)[1]: WSL allows Linux processes to
+// reach NTFS-mounted worktrees on Windows hosts, so the
+// is_ntfs_dotgit guard cannot safely be gated on the runtime OS.
+//
+// [1]: https://github.com/git/git/commit/9102f958ee5
+func defaultProtectNTFS() bool {
+	return true
+}
+
+// worktreeFilesystem wraps a billy.Filesystem and validates every path it
+// is handed, so worktree operations cannot use dangerous paths at the
+// boundary. Two layers apply:
+//
+//   - validPath rejects dangerous path *strings*: .git and its HFS+/NTFS
+//     variants, "..", control characters, volume names.
+//   - validNoLeadingSymlink rejects paths whose leading directories
+//     already exist on disk as symlinks, so a write or delete cannot
+//     follow a planted link out of the tree.
+//
+// Both layers run on every mutating operation (validWritePath) and every
+// read (validReadPath). Chroot additionally refuses a symlink as the final
+// component, so a sub-filesystem such as a submodule worktree cannot be
+// scoped to a redirected target.
+//
+// The wrapper intentionally stops at leading-component traversal. Callers
+// that need final-component no-follow semantics for materialisation
+// (checkoutFile) enforce that directly by removing the blocking symlink
+// before opening the destination path.
+type worktreeFilesystem struct {
+	billy.Filesystem
+	protectNTFS bool
+	protectHFS  bool
+}
+
+func newWorktreeFilesystem(fs billy.Filesystem, protectNTFS, protectHFS bool) *worktreeFilesystem {
+	return &worktreeFilesystem{Filesystem: fs, protectNTFS: protectNTFS, protectHFS: protectHFS}
+}
+
+func (sfs *worktreeFilesystem) Create(filename string) (billy.File, error) {
+	if err := sfs.validWritePath(filename); err != nil {
+		return nil, fmt.Errorf("create: %w", err)
+	}
+	return sfs.Filesystem.Create(filename)
+}
+
+func (sfs *worktreeFilesystem) Open(filename string) (billy.File, error) {
+	if err := sfs.validReadPath(filename); err != nil {
+		return nil, fmt.Errorf("open: %w", err)
+	}
+	return sfs.Filesystem.Open(filename)
+}
+
+func (sfs *worktreeFilesystem) OpenFile(filename string, flag int, perm os.FileMode) (billy.File, error) {
+	if err := sfs.validWritePath(filename); err != nil {
+		return nil, fmt.Errorf("openfile: %w", err)
+	}
+	return sfs.Filesystem.OpenFile(filename, flag, perm)
+}
+
+func (sfs *worktreeFilesystem) Stat(filename string) (os.FileInfo, error) {
+	if err := sfs.validReadPath(filename); err != nil {
+		return nil, fmt.Errorf("stat: %w", err)
+	}
+	return sfs.Filesystem.Stat(filename)
+}
+
+func (sfs *worktreeFilesystem) Remove(filename string) error {
+	if err := sfs.validWritePath(filename); err != nil {
+		return fmt.Errorf("remove: %w", err)
+	}
+	return sfs.Filesystem.Remove(filename)
+}
+
+func (sfs *worktreeFilesystem) Rename(from, to string) error {
+	if err := sfs.validWritePath(from, to); err != nil {
+		return fmt.Errorf("rename: %w", err)
+	}
+	return sfs.Filesystem.Rename(from, to)
+}
+
+func (sfs *worktreeFilesystem) ReadDir(path string) ([]os.FileInfo, error) {
+	if err := sfs.validReadPath(path); err != nil {
+		return nil, fmt.Errorf("readdir: %w", err)
+	}
+	return sfs.Filesystem.ReadDir(path)
+}
+
+func (sfs *worktreeFilesystem) Lstat(filename string) (os.FileInfo, error) {
+	if err := sfs.validReadPath(filename); err != nil {
+		return nil, fmt.Errorf("lstat: %w", err)
+	}
+	return sfs.Filesystem.Lstat(filename)
+}
+
+func (sfs *worktreeFilesystem) Symlink(target, link string) error {
+	if err := sfs.validWritePath(link); err != nil {
+		return fmt.Errorf("symlink: %w", err)
+	}
+	if err := sfs.validSymlinkName(link); err != nil {
+		return fmt.Errorf("symlink: %w", err)
+	}
+	return sfs.Filesystem.Symlink(target, link)
+}
+
+func (sfs *worktreeFilesystem) Readlink(link string) (string, error) {
+	if err := sfs.validReadPath(link); err != nil {
+		return "", fmt.Errorf("readlink: %w", err)
+	}
+	return sfs.Filesystem.Readlink(link)
+}
+
+func (sfs *worktreeFilesystem) MkdirAll(path string, perm os.FileMode) error {
+	// MkdirAll on the worktree root is a no-op: the root always exists,
+	// so there is nothing to materialise. Mirroring the tolerance that
+	// validReadPath gives to read-side operations avoids breaking callers
+	// that walk a directory tree and pass the relative-to-root prefix
+	// ("") through to the worktree FS.
+	if path == "" || path == "." || path == "/" {
+		return nil
+	}
+	if err := sfs.validWritePath(path); err != nil {
+		return fmt.Errorf("mkdirall: %w", err)
+	}
+	return sfs.Filesystem.MkdirAll(path, perm)
+}
+
+func (sfs *worktreeFilesystem) TempFile(_, _ string) (billy.File, error) {
+	return nil, fmt.Errorf("tempfile: %w", errUnsupportedOperation)
+}
+
+func (sfs *worktreeFilesystem) Chroot(path string) (billy.Filesystem, error) {
+	if err := sfs.validReadPath(path); err != nil {
+		return nil, fmt.Errorf("chroot: %w", err)
+	}
+	// Chroot scopes a sub-filesystem to path, so the final component must
+	// be a real directory too: a symlink there would silently redirect the
+	// scope (e.g. a submodule worktree) to a target outside the tree. This
+	// is the "valid path, wrong target" case that validNoLeadingSymlink,
+	// which only inspects leading components, does not cover.
+	//
+	// A non-existent target is fine: Chroot creates it as a real
+	// directory. Any other Lstat error means we cannot prove the target
+	// is not a symlink, so fail closed rather than scope through it.
+	if fi, err := sfs.Filesystem.Lstat(path); err != nil {
+		if !os.IsNotExist(err) {
+			return nil, fmt.Errorf("chroot: cannot stat %q: %w", path, err)
+		}
+	} else if fi.Mode()&os.ModeSymlink != 0 {
+		return nil, fmt.Errorf("chroot: invalid path %q: is a symlink", path)
+	}
+	return sfs.Filesystem.Chroot(path)
+}
+
+// validReadPath is like validWritePath but treats the empty string and "."
+// as valid references to the worktree root. Read-side operations on the
+// root (e.g. ReadDir(""), Lstat(".")) are legitimate. Mutating the root
+// itself is not, so write-side operations reject it via validPath. Reads
+// are still refused through a leading symlink, so the wrapper never
+// follows a planted link even on the read surface.
+func (sfs *worktreeFilesystem) validReadPath(p string) error {
+	if p == "" || p == "." || p == "/" {
+		return nil
+	}
+	if err := sfs.validPath(p); err != nil {
+		return err
+	}
+	return sfs.validNoLeadingSymlink(p)
+}
+
+var errUnsupportedOperation = errors.New("unsupported operation")
+
+// isDotGitVariant reports whether part is .git, git~1, or an HFS+
+// equivalent of .git (when protectHFS is true). NTFS variants of .git
+// (e.g. ".git " with trailing space, ".git::$INDEX_ALLOCATION") are
+// detected separately by pathutil.WindowsValidPath, which applies
+// regardless of position in the path. Both validators reuse this
+// helper.
+func isDotGitVariant(part string, protectHFS bool) bool {
+	if pathutil.IsDotGitName(part) {
+		return true
+	}
+	if protectHFS && pathutil.IsHFSDotGit(part) {
+		return true
+	}
+	return false
+}
+
+// validPath checks whether paths are valid for the worktree
+// filesystem abstraction. It is intentionally tolerant of .git as
+// the final path component of a multi-component path
+// (e.g. "submodule/.git"), so that legitimate gitlink pointer files
+// can still be Stat'd, Read, and Removed via the wrapper during
+// submodule cleanup. Attacker-controlled tree-entry paths are
+// validated separately by pathutil.ValidTreePath at the boundaries
+// where data leaves the trusted store (Tree.FindEntry, the explicit
+// callers in CherryPick and Submodule.Repository).
+//
+// For upstream rules:
+// https://github.com/git/git/blob/v2.54.0/read-cache.c#L987
+// https://github.com/git/git/blob/v2.54.0/path.c#L1419
+func (sfs *worktreeFilesystem) validPath(paths ...string) error {
+	for _, p := range paths {
+		for i := 0; i < len(p); i++ {
+			if p[i] < 0x20 || p[i] == 0x7f {
+				return fmt.Errorf("invalid path %q: contains control character", p)
+			}
+		}
+
+		parts := strings.FieldsFunc(p, func(r rune) bool { return (r == '\\' || r == '/') })
+		if len(parts) == 0 {
+			return fmt.Errorf("invalid path: %q", p)
+		}
+
+		if sfs.protectNTFS {
+			// Volume names are not supported, in both formats: \\ and <DRIVE_LETTER>:.
+			if vol := filepath.VolumeName(p); vol != "" {
+				return fmt.Errorf("invalid path: %q", p)
+			}
+		}
+
+		for i, part := range parts {
+			if part == "." || part == ".." {
+				return fmt.Errorf("invalid path %q: cannot use %q", p, part)
+			}
+
+			// Reject .git (and equivalents) as a path component when it is
+			// either the first component (root-level .git) or a non-final
+			// component (traversal into a .git directory, e.g. "a/.git/config").
+			// A final non-first .git component (e.g. "submodule/.git") is
+			// allowed because submodule worktrees contain a .git pointer file.
+			if isDotGitVariant(part, sfs.protectHFS) && (i == 0 || i < len(parts)-1) {
+				return fmt.Errorf("invalid path component: %q", p)
+			}
+
+			if sfs.protectNTFS && !pathutil.WindowsValidPath(part) {
+				return fmt.Errorf("invalid path: %q", p)
+			}
+		}
+	}
+	return nil
+}
+
+// validWritePath validates paths for mutating operations. It layers the
+// filesystem-state check validNoLeadingSymlink on top of the string-only
+// checks in validPath, so a write can neither name a dangerous path nor
+// reach one by traversing an existing symlink. Every mutating method on
+// the wrapper funnels through here, so the leading-symlink invariant holds
+// for all worktree writers without each call site having to remember it.
+func (sfs *worktreeFilesystem) validWritePath(paths ...string) error {
+	if err := sfs.validPath(paths...); err != nil {
+		return err
+	}
+	return sfs.validNoLeadingSymlink(paths...)
+}
+
+// validNoLeadingSymlink rejects paths whose leading directory components
+// resolve through a symlink that already exists on the underlying
+// filesystem. validPath guards the path string. This guards the on-disk
+// state, so a write or delete cannot reach outside the worktree by
+// traversing a symlink that a tree or an earlier step left in place.
+//
+// This is the fail-closed backstop for the whole class. Callers that want
+// upstream's replace-and-continue behaviour (checkout) remove the blocking
+// symlink first via clearBlockingSymlinks, so no symlink remains when the
+// write reaches the wrapper. Callers that do not get a safe error,
+// matching upstream Git refusing rather than following the link. See
+// has_symlink_leading_path (symlinks.c) and the check_leading_path guard
+// in unlink_entry (entry.c).
+func (sfs *worktreeFilesystem) validNoLeadingSymlink(paths ...string) error {
+	for _, p := range paths {
+		for dir := filepath.Dir(p); dir != "." && dir != "" && dir != string(filepath.Separator); dir = filepath.Dir(dir) {
+			fi, err := sfs.Filesystem.Lstat(dir)
+			if err != nil {
+				// A missing ancestor is materialised as a real directory,
+				// so it cannot be a symlink and is safe to skip. Any other
+				// error (permission, I/O) means we cannot prove the
+				// component is not a symlink, so fail closed rather than
+				// let the operation traverse an unverified component.
+				if os.IsNotExist(err) {
+					continue
+				}
+				return fmt.Errorf("invalid path %q: cannot stat leading component %q: %w", p, dir, err)
+			}
+			if fi.Mode()&os.ModeSymlink != 0 {
+				return fmt.Errorf("invalid path %q: leading component %q is a symlink", p, dir)
+			}
+		}
+	}
+	return nil
+}
+
+// validSymlinkName checks the per-component name of a symlink for
+// dotfile names that attackers can use to trick a checkout into
+// writing a dangerous symlink. Each path component is compared
+// against .gitmodules case-insensitively, against its NTFS variants
+// (e.g. ".gitmodules .", ".gitmodules::$INDEX_ALLOCATION", or 8.3
+// short-name forms) when protectNTFS is on, and against its HFS+
+// variants (Unicode ignored code points folded into ".gitmodules")
+// when protectHFS is on.
+//
+// Reference: upstream Git verify_path_internal at read-cache.c#L1004-L1024
+// in tag v2.54.0[1].
+//
+// [1]: https://github.com/git/git/blob/v2.54.0/read-cache.c#L1004-L1024
+func (sfs *worktreeFilesystem) validSymlinkName(name string) error {
+	parts := strings.FieldsFunc(name, func(r rune) bool {
+		return r == '/' || r == '\\'
+	})
+	for _, part := range parts {
+		if strings.EqualFold(part, gitmodulesFile) {
+			return ErrGitModulesSymlink
+		}
+		if sfs.protectNTFS && pathutil.IsNTFSDotGitmodules(part) {
+			return ErrGitModulesSymlink
+		}
+		if sfs.protectHFS && pathutil.IsHFSDotGitmodules(part) {
+			return ErrGitModulesSymlink
+		}
+	}
+	return nil
+}
@@ -10,6 +10,7 @@ import (
 	"strings"

 	"github.com/go-git/go-billy/v5/util"
+	"github.com/go-git/go-git/v5/internal/pathutil"
 	"github.com/go-git/go-git/v5/plumbing"
 	"github.com/go-git/go-git/v5/plumbing/filemode"
 	"github.com/go-git/go-git/v5/plumbing/format/gitignore"
@@ -370,7 +371,7 @@ func (w *Worktree) doAdd(path string, ignorePattern []gitignore.Pattern, skipSta
 		}
 	}

-	path = filepath.Clean(path)
+	path = filepath.ToSlash(filepath.Clean(path))

 	if err != nil || !fi.IsDir() {
 		added, h, err = w.doAddFile(idx, s, path, ignorePattern)
@@ -545,6 +546,14 @@ func (w *Worktree) addOrUpdateFileToIndex(idx *index.Index, filename string, h p
 }

 func (w *Worktree) doAddFileToIndex(idx *index.Index, filename string, h plumbing.Hash) error {
+	// Mirror upstream's Index.Add gate at the v5 caller boundary: the
+	// index feeds future trees, so a name that the tree-side
+	// pathutil.ValidTreePath gate would reject must not enter the
+	// index in the first place. v5 keeps Index.Add's existing signature
+	// for API compatibility, so the validation happens here.
+	if err := pathutil.ValidTreePath(filename); err != nil {
+		return err
+	}
 	return w.doUpdateFileToIndex(idx.Add(filename), filename, h)
 }

@@ -1,24 +0,0 @@
-# Compiled Object files, Static and Dynamic libs (Shared Objects)
-*.o
-*.a
-*.so
-
-# Folders
-_obj
-_test
-
-# Architecture specific extensions/prefixes
-*.[568vq]
-[568vq].out
-
-*.cgo1.go
-*.cgo2.c
-_cgo_defun.c
-_cgo_gotypes.go
-_cgo_export.*
-
-_testmain.go
-
-*.exe
-*.test
-*.prof
@@ -1,57 +0,0 @@
-version: 2
-
-builds:
-  -
-    id: "cpuid"
-    binary: cpuid
-    main: ./cmd/cpuid/main.go
-    env:
-      - CGO_ENABLED=0
-    flags:
-      - -ldflags=-s -w
-    goos:
-      - aix
-      - linux
-      - freebsd
-      - netbsd
-      - windows
-      - darwin
-    goarch:
-      - 386
-      - amd64
-      - arm64
-    goarm:
-      - 7
-
-archives:
-  -
-    id: cpuid
-    name_template: "cpuid-{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}"
-    format_overrides:
-      - goos: windows
-        format: zip
-    files:
-      - LICENSE
-checksum:
-  name_template: 'checksums.txt'
-changelog:
-  sort: asc
-  filters:
-    exclude:
-    - '^doc:'
-    - '^docs:'
-    - '^test:'
-    - '^tests:'
-    - '^Update\sREADME.md'
-
-nfpms:
-  -
-    file_name_template: "cpuid_package_{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}"
-    vendor: Klaus Post
-    homepage: https://github.com/klauspost/cpuid
-    maintainer: Klaus Post <klauspost@gmail.com>
-    description: CPUID Tool
-    license: BSD 3-Clause
-    formats:
-      - deb
-      - rpm
@@ -1,35 +0,0 @@
-Developer Certificate of Origin
-Version 1.1
-
-Copyright (C) 2015- Klaus Post & Contributors.
-Email: klauspost@gmail.com
-
-Everyone is permitted to copy and distribute verbatim copies of this
-license document, but changing it is not allowed.
-
-
-Developer's Certificate of Origin 1.1
-
-By making a contribution to this project, I certify that:
-
-(a) The contribution was created in whole or in part by me and I
-    have the right to submit it under the open source license
-    indicated in the file; or
-
-(b) The contribution is based upon previous work that, to the best
-    of my knowledge, is covered under an appropriate open source
-    license and I have the right under that license to submit that
-    work with modifications, whether created in whole or in part
-    by me, under the same open source license (unless I am
-    permitted to submit under a different license), as indicated
-    in the file; or
-
-(c) The contribution was provided directly to me by some other
-    person who certified (a), (b) or (c) and I have not modified
-    it.
-
-(d) I understand and agree that this project and the contribution
-    are public and that a record of the contribution (including all
-    personal information I submit with it, including my sign-off) is
-    maintained indefinitely and may be redistributed consistent with
-    this project or the open source license(s) involved.
@@ -1,22 +0,0 @@
-The MIT License (MIT)
-
-Copyright (c) 2015 Klaus Post
-
-Permission is hereby granted, free of charge, to any person obtaining a copy
-of this software and associated documentation files (the "Software"), to deal
-in the Software without restriction, including without limitation the rights
-to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-copies of the Software, and to permit persons to whom the Software is
-furnished to do so, subject to the following conditions:
-
-The above copyright notice and this permission notice shall be included in all
-copies or substantial portions of the Software.
-
-THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE
-SOFTWARE.
-
@@ -1,512 +0,0 @@
-# cpuid
-Package cpuid provides information about the CPU running the current program.
-
-CPU features are detected on startup, and kept for fast access through the life of the application.
-Currently x86 / x64 (AMD64/i386) and ARM (ARM64) is supported, and no external C (cgo) code is used, which should make the library very easy to use.
-
-You can access the CPU information by accessing the shared CPU variable of the cpuid library.
-
-Package home: https://github.com/klauspost/cpuid
-
-[![PkgGoDev](https://pkg.go.dev/badge/github.com/klauspost/cpuid)](https://pkg.go.dev/github.com/klauspost/cpuid/v2)
-[![Go](https://github.com/klauspost/cpuid/actions/workflows/go.yml/badge.svg)](https://github.com/klauspost/cpuid/actions/workflows/go.yml)
-
-## installing
-
-`go get -u github.com/klauspost/cpuid/v2` using modules.
-Drop `v2` for others.
-
-Installing binary:
-
-`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
-
-Or download binaries from release page: https://github.com/klauspost/cpuid/releases
-
-### Homebrew
-
-For macOS/Linux users, you can install via [brew](https://brew.sh/)
-
-```sh
-$ brew install cpuid
-```
-
-## example
-
-```Go
-package main
-
-import (
-	"fmt"
-	"strings"
-
-	. "github.com/klauspost/cpuid/v2"
-)
-
-func main() {
-	// Print basic CPU information:
-	fmt.Println("Name:", CPU.BrandName)
-	fmt.Println("PhysicalCores:", CPU.PhysicalCores)
-	fmt.Println("ThreadsPerCore:", CPU.ThreadsPerCore)
-	fmt.Println("LogicalCores:", CPU.LogicalCores)
-	fmt.Println("Family", CPU.Family, "Model:", CPU.Model, "Vendor ID:", CPU.VendorID)
-	fmt.Println("Features:", strings.Join(CPU.FeatureSet(), ","))
-	fmt.Println("Cacheline bytes:", CPU.CacheLine)
-	fmt.Println("L1 Data Cache:", CPU.Cache.L1D, "bytes")
-	fmt.Println("L1 Instruction Cache:", CPU.Cache.L1I, "bytes")
-	fmt.Println("L2 Cache:", CPU.Cache.L2, "bytes")
-	fmt.Println("L3 Cache:", CPU.Cache.L3, "bytes")
-	fmt.Println("Frequency", CPU.Hz, "hz")
-
-	// Test if we have these specific features:
-	if CPU.Supports(SSE, SSE2) {
-		fmt.Println("We have Streaming SIMD 2 Extensions")
-	}
-}
-```
-
-Sample output:
-```
->go run main.go
-Name: AMD Ryzen 9 3950X 16-Core Processor
-PhysicalCores: 16
-ThreadsPerCore: 2
-LogicalCores: 32
-Family 23 Model: 113 Vendor ID: AMD
-Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CMOV,CX16,F16C,FMA3,HTT,HYPERVISOR,LZCNT,MMX,MMXEXT,NX,POPCNT,RDRAND,RDSEED,RDTSCP,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3
-Cacheline bytes: 64
-L1 Data Cache: 32768 bytes
-L1 Instruction Cache: 32768 bytes
-L2 Cache: 524288 bytes
-L3 Cache: 16777216 bytes
-Frequency 0 hz
-We have Streaming SIMD 2 Extensions
-```
-
-# usage
-
-The `cpuid.CPU` provides access to CPU features. Use `cpuid.CPU.Supports()` to check for CPU features.
-A faster `cpuid.CPU.Has()` is provided which will usually be inlined by the gc compiler.  
-
-To test a larger number of features, they can be combined using `f := CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2)`, etc.
-This can be using with `cpuid.CPU.HasAll(f)` to quickly test if all features are supported.
-
-Note that for some cpu/os combinations some features will not be detected.
-`amd64` has rather good support and should work reliably on all platforms.
-
-Note that hypervisors may not pass through all CPU features through to the guest OS,
-so even if your host supports a feature it may not be visible on guests.
-
-## arm64 feature detection
-
-Not all operating systems provide ARM features directly 
-and there is no safe way to do so for the rest.
-
-Currently `arm64/linux` and `arm64/freebsd` should be quite reliable. 
-`arm64/darwin` adds features expected from the M1 processor, but a lot remains undetected.
-
-A `DetectARM()` can be used if you are able to control your deployment,
-it will detect CPU features, but may crash if the OS doesn't intercept the calls.
-A `-cpu.arm` flag for detecting unsafe ARM features can be added. See below.
- 
-Note that currently only features are detected on ARM, 
-no additional information is currently available. 
-
-## flags
-
-It is possible to add flags that affects cpu detection.
-
-For this the `Flags()` command is provided.
-
-This must be called *before* `flag.Parse()` AND after the flags have been parsed `Detect()` must be called.
-
-This means that any detection used in `init()` functions will not contain these flags.
-
-Example:
-
-```Go
-package main
-
-import (
-	"flag"
-	"fmt"
-	"strings"
-
-	"github.com/klauspost/cpuid/v2"
-)
-
-func main() {
-	cpuid.Flags()
-	flag.Parse()
-	cpuid.Detect()
-
-	// Test if we have these specific features:
-	if cpuid.CPU.Supports(cpuid.SSE, cpuid.SSE2) {
-		fmt.Println("We have Streaming SIMD 2 Extensions")
-	}
-}
-```
-
-## commandline
-
-Download as binary from: https://github.com/klauspost/cpuid/releases
-
-Install from source:
-
-`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
-
-### Example
-
-```
-λ cpuid
-Name: AMD Ryzen 9 3950X 16-Core Processor
-Vendor String: AuthenticAMD
-Vendor ID: AMD
-PhysicalCores: 16
-Threads Per Core: 2
-Logical Cores: 32
-CPU Family 23 Model: 113
-Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CLZERO,CMOV,CMPXCHG8,CPBOOST,CX16,F16C,FMA3,FXSR,FXSROPT,HTT,HYPERVISOR,LAHF,LZCNT,MCAOVERFLOW,MMX,MMXEXT,MOVBE,NX,OSXSAVE,POPCNT,RDRAND,RDSEED,RDTSCP,SCE,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3,SUCCOR,X87,XSAVE
-Microarchitecture level: 3
-Cacheline bytes: 64
-L1 Instruction Cache: 32768 bytes
-L1 Data Cache: 32768 bytes
-L2 Cache: 524288 bytes
-L3 Cache: 16777216 bytes
-
-```
-### JSON Output:
-
-```
-λ cpuid --json
-{
-  "BrandName": "AMD Ryzen 9 3950X 16-Core Processor",
-  "VendorID": 2,
-  "VendorString": "AuthenticAMD",
-  "PhysicalCores": 16,
-  "ThreadsPerCore": 2,
-  "LogicalCores": 32,
-  "Family": 23,
-  "Model": 113,
-  "CacheLine": 64,
-  "Hz": 0,
-  "BoostFreq": 0,
-  "Cache": {
-    "L1I": 32768,
-    "L1D": 32768,
-    "L2": 524288,
-    "L3": 16777216
-  },
-  "SGX": {
-    "Available": false,
-    "LaunchControl": false,
-    "SGX1Supported": false,
-    "SGX2Supported": false,
-    "MaxEnclaveSizeNot64": 0,
-    "MaxEnclaveSize64": 0,
-    "EPCSections": null
-  },
-  "Features": [
-    "ADX",
-    "AESNI",
-    "AVX",
-    "AVX2",
-    "BMI1",
-    "BMI2",
-    "CLMUL",
-    "CLZERO",
-    "CMOV",
-    "CMPXCHG8",
-    "CPBOOST",
-    "CX16",
-    "F16C",
-    "FMA3",
-    "FXSR",
-    "FXSROPT",
-    "HTT",
-    "HYPERVISOR",
-    "LAHF",
-    "LZCNT",
-    "MCAOVERFLOW",
-    "MMX",
-    "MMXEXT",
-    "MOVBE",
-    "NX",
-    "OSXSAVE",
-    "POPCNT",
-    "RDRAND",
-    "RDSEED",
-    "RDTSCP",
-    "SCE",
-    "SHA",
-    "SSE",
-    "SSE2",
-    "SSE3",
-    "SSE4",
-    "SSE42",
-    "SSE4A",
-    "SSSE3",
-    "SUCCOR",
-    "X87",
-    "XSAVE"
-  ],
-  "X64Level": 3
-}
-```
-
-### Check CPU microarch level
-
-```
-λ cpuid --check-level=3
-2022/03/18 17:04:40 AMD Ryzen 9 3950X 16-Core Processor
-2022/03/18 17:04:40 Microarchitecture level 3 is supported. Max level is 3.
-Exit Code 0
-
-λ cpuid --check-level=4
-2022/03/18 17:06:18 AMD Ryzen 9 3950X 16-Core Processor
-2022/03/18 17:06:18 Microarchitecture level 4 not supported. Max level is 3.
-Exit Code 1
-```
-
-
-## Available flags
-
-### x86 & amd64 
-
-| Feature Flag       | Description                                                                                                                                                                        |
-|--------------------|------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------|
-| ADX                | Intel ADX (Multi-Precision Add-Carry Instruction Extensions)                                                                                                                       |
-| AESNI              | Advanced Encryption Standard New Instructions                                                                                                                                      |
-| AMD3DNOW           | AMD 3DNOW                                                                                                                                                                          |
-| AMD3DNOWEXT        | AMD 3DNowExt                                                                                                                                                                       |
-| AMXBF16            | Tile computational operations on BFLOAT16 numbers                                                                                                                                  |
-| AMXINT8            | Tile computational operations on 8-bit integers                                                                                                                                    |
-| AMXFP16            | Tile computational operations on FP16 numbers                                                                                                                                      |
-| AMXFP8             | Tile computational operations on FP8 numbers                                                                                                                                       |
-| AMXCOMPLEX         | Tile computational operations on complex numbers                                                                                                                                   |
-| AMXTILE            | Tile architecture                                                                                                                                                                  |
-| AMXTF32            | Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile                                                                                                              |
-| AMXTRANSPOSE       | Tile multiply where the first operand is transposed                                                                                                                                |
-| APX_F              | Intel APX                                                                                                                                                                          |
-| AVX                | AVX functions                                                                                                                                                                      |
-| AVX10              | If set the Intel AVX10 Converged Vector ISA is supported                                                                                                                           |
-| AVX10_128          | If set indicates that AVX10 128-bit vector support is present                                                                                                                      |
-| AVX10_256          | If set indicates that AVX10 256-bit vector support is present                                                                                                                      |
-| AVX10_512          | If set indicates that AVX10 512-bit vector support is present                                                                                                                      |
-| AVX2               | AVX2 functions                                                                                                                                                                     |
-| AVX512BF16         | AVX-512 BFLOAT16 Instructions                                                                                                                                                      |
-| AVX512BITALG       | AVX-512 Bit Algorithms                                                                                                                                                             |
-| AVX512BW           | AVX-512 Byte and Word Instructions                                                                                                                                                 |
-| AVX512CD           | AVX-512 Conflict Detection Instructions                                                                                                                                            |
-| AVX512DQ           | AVX-512 Doubleword and Quadword Instructions                                                                                                                                       |
-| AVX512ER           | AVX-512 Exponential and Reciprocal Instructions                                                                                                                                    |
-| AVX512F            | AVX-512 Foundation                                                                                                                                                                 |
-| AVX512FP16         | AVX-512 FP16 Instructions                                                                                                                                                          |
-| AVX512IFMA         | AVX-512 Integer Fused Multiply-Add Instructions                                                                                                                                    |
-| AVX512PF           | AVX-512 Prefetch Instructions                                                                                                                                                      |
-| AVX512VBMI         | AVX-512 Vector Bit Manipulation Instructions                                                                                                                                       |
-| AVX512VBMI2        | AVX-512 Vector Bit Manipulation Instructions, Version 2                                                                                                                            |
-| AVX512VL           | AVX-512 Vector Length Extensions                                                                                                                                                   |
-| AVX512VNNI         | AVX-512 Vector Neural Network Instructions                                                                                                                                         |
-| AVX512VP2INTERSECT | AVX-512 Intersect for D/Q                                                                                                                                                          |
-| AVX512VPOPCNTDQ    | AVX-512 Vector Population Count Doubleword and Quadword                                                                                                                            |
-| AVXIFMA            | AVX-IFMA instructions                                                                                                                                                              |
-| AVXNECONVERT       | AVX-NE-CONVERT instructions                                                                                                                                                        |
-| AVXSLOW            | Indicates the CPU performs 2 128 bit operations instead of one                                                                                                                     |
-| AVXVNNI            | AVX (VEX encoded) VNNI neural network instructions                                                                                                                                 |
-| AVXVNNIINT8        | AVX-VNNI-INT8 instructions                                                                                                                                                         |
-| AVXVNNIINT16       | AVX-VNNI-INT16 instructions                                                                                                                                                        |
-| BHI_CTRL           | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598                                                                    |
-| BMI1               | Bit Manipulation Instruction Set 1                                                                                                                                                 |
-| BMI2               | Bit Manipulation Instruction Set 2                                                                                                                                                 |
-| CETIBT             | Intel CET Indirect Branch Tracking                                                                                                                                                 |
-| CETSS              | Intel CET Shadow Stack                                                                                                                                                             |
-| CLDEMOTE           | Cache Line Demote                                                                                                                                                                  |
-| CLMUL              | Carry-less Multiplication                                                                                                                                                          |
-| CLZERO             | CLZERO instruction supported                                                                                                                                                       |
-| CMOV               | i686 CMOV                                                                                                                                                                          |
-| CMPCCXADD          | CMPCCXADD instructions                                                                                                                                                             |
-| CMPSB_SCADBS_SHORT | Fast short CMPSB and SCASB                                                                                                                                                         |
-| CMPXCHG8           | CMPXCHG8 instruction                                                                                                                                                               |
-| CPBOOST            | Core Performance Boost                                                                                                                                                             |
-| CPPC               | AMD: Collaborative Processor Performance Control                                                                                                                                   |
-| CX16               | CMPXCHG16B Instruction                                                                                                                                                             |
-| EFER_LMSLE_UNS     | AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ                                                                                                                        |
-| ENQCMD             | Enqueue Command                                                                                                                                                                    |
-| ERMS               | Enhanced REP MOVSB/STOSB                                                                                                                                                           |
-| F16C               | Half-precision floating-point conversion                                                                                                                                           |
-| FLUSH_L1D          | Flush L1D cache                                                                                                                                                                    |
-| FMA3               | Intel FMA 3. Does not imply AVX.                                                                                                                                                   |
-| FMA4               | Bulldozer FMA4 functions                                                                                                                                                           |
-| FP128              | AMD: When set, the internal FP/SIMD execution datapath is 128-bits wide                                                                                                            |
-| FP256              | AMD: When set, the internal FP/SIMD execution datapath is 256-bits wide                                                                                                            |
-| FSRM               | Fast Short Rep Mov                                                                                                                                                                 |
-| FXSR               | FXSAVE, FXRESTOR instructions, CR4 bit 9                                                                                                                                           |
-| FXSROPT            | FXSAVE/FXRSTOR optimizations                                                                                                                                                       |
-| GFNI               | Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage.                                                                                  |
-| HLE                | Hardware Lock Elision                                                                                                                                                              |
-| HRESET             | If set CPU supports history reset and the IA32_HRESET_ENABLE MSR                                                                                                                   |
-| HTT                | Hyperthreading (enabled)                                                                                                                                                           |
-| HWA                | Hardware assert supported. Indicates support for MSRC001_10                                                                                                                        |
-| HYBRID_CPU         | This part has CPUs of more than one type.                                                                                                                                          |
-| HYPERVISOR         | This bit has been reserved by Intel & AMD for use by hypervisors                                                                                                                   |
-| IA32_ARCH_CAP      | IA32_ARCH_CAPABILITIES MSR (Intel)                                                                                                                                                 |
-| IA32_CORE_CAP      | IA32_CORE_CAPABILITIES MSR                                                                                                                                                         |
-| IBPB               | Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB)                                                                                         |
-| IBRS               | AMD: Indirect Branch Restricted Speculation                                                                                                                                        |
-| IBRS_PREFERRED     | AMD: IBRS is preferred over software solution                                                                                                                                      |
-| IBRS_PROVIDES_SMP  | AMD: IBRS provides Same Mode Protection                                                                                                                                            |
-| IBS                | Instruction Based Sampling (AMD)                                                                                                                                                   |
-| IBSBRNTRGT         | Instruction Based Sampling Feature (AMD)                                                                                                                                           |
-| IBSFETCHSAM        | Instruction Based Sampling Feature (AMD)                                                                                                                                           |
-| IBSFFV             | Instruction Based Sampling Feature (AMD)                                                                                                                                           |
-| IBSOPCNT           | Instruction Based Sampling Feature (AMD)                                                                                                                                           |
-| IBSOPCNTEXT        | Instruction Based Sampling Feature (AMD)                                                                                                                                           |
-| IBSOPSAM           | Instruction Based Sampling Feature (AMD)                                                                                                                                           |
-| IBSRDWROPCNT       | Instruction Based Sampling Feature (AMD)                                                                                                                                           |
-| IBSRIPINVALIDCHK   | Instruction Based Sampling Feature (AMD)                                                                                                                                           |
-| IBS_FETCH_CTLX     | AMD: IBS fetch control extended MSR supported                                                                                                                                      |
-| IBS_OPDATA4        | AMD: IBS op data 4 MSR supported                                                                                                                                                   |
-| IBS_OPFUSE         | AMD: Indicates support for IbsOpFuse                                                                                                                                               |
-| IBS_PREVENTHOST    | Disallowing IBS use by the host supported                                                                                                                                          |
-| IBS_ZEN4           | Fetch and Op IBS support IBS extensions added with Zen4                                                                                                                            |
-| IDPRED_CTRL        | IPRED_DIS                                                                                                                                                                          |
-| INT_WBINVD         | WBINVD/WBNOINVD are interruptible.                                                                                                                                                 |
-| INVLPGB            | NVLPGB and TLBSYNC instruction supported                                                                                                                                           |
-| KEYLOCKER          | Key locker                                                                                                                                                                         |
-| KEYLOCKERW         | Key locker wide                                                                                                                                                                    |
-| LAHF               | LAHF/SAHF in long mode                                                                                                                                                             |
-| LAM                | If set, CPU supports Linear Address Masking                                                                                                                                        |
-| LBRVIRT            | LBR virtualization                                                                                                                                                                 |
-| LZCNT              | LZCNT instruction                                                                                                                                                                  |
-| MCAOVERFLOW        | MCA overflow recovery support.                                                                                                                                                     |
-| MCDT_NO            | Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it.                                                                             |
-| MCOMMIT            | MCOMMIT instruction supported                                                                                                                                                      |
-| MD_CLEAR           | VERW clears CPU buffers                                                                                                                                                            |
-| MMX                | standard MMX                                                                                                                                                                       |
-| MMXEXT             | SSE integer functions or AMD MMX ext                                                                                                                                               |
-| MOVBE              | MOVBE instruction (big-endian)                                                                                                                                                     |
-| MOVDIR64B          | Move 64 Bytes as Direct Store                                                                                                                                                      |
-| MOVDIRI            | Move Doubleword as Direct Store                                                                                                                                                    |
-| MOVSB_ZL           | Fast Zero-Length MOVSB                                                                                                                                                             |
-| MPX                | Intel MPX (Memory Protection Extensions)                                                                                                                                           |
-| MOVU               | MOVU SSE instructions are more efficient and should be preferred to SSE	MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD        |
-| MSRIRC             | Instruction Retired Counter MSR available                                                                                                                                          |
-| MSRLIST            | Read/Write List of Model Specific Registers                                                                                                                                        |
-| MSR_PAGEFLUSH      | Page Flush MSR available                                                                                                                                                           |
-| NRIPS              | Indicates support for NRIP save on VMEXIT                                                                                                                                          |
-| NX                 | NX (No-Execute) bit                                                                                                                                                                |
-| OSXSAVE            | XSAVE enabled by OS                                                                                                                                                                |
-| PCONFIG            | PCONFIG for Intel Multi-Key Total Memory Encryption                                                                                                                                |
-| POPCNT             | POPCNT instruction                                                                                                                                                                 |
-| PPIN               | AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled                                            |
-| PREFETCHI          | PREFETCHIT0/1 instructions                                                                                                                                                         |
-| PSFD               | Predictive Store Forward Disable                                                                                                                                                   |
-| RDPRU              | RDPRU instruction supported                                                                                                                                                        |
-| RDRAND             | RDRAND instruction is available                                                                                                                                                    |
-| RDSEED             | RDSEED instruction is available                                                                                                                                                    |
-| RDTSCP             | RDTSCP Instruction                                                                                                                                                                 |
-| RRSBA_CTRL         | Restricted RSB Alternate                                                                                                                                                           |
-| RTM                | Restricted Transactional Memory                                                                                                                                                    |
-| RTM_ALWAYS_ABORT   | Indicates that the loaded microcode is forcing RTM abort.                                                                                                                          |
-| SERIALIZE          | Serialize Instruction Execution                                                                                                                                                    |
-| SEV                | AMD Secure Encrypted Virtualization supported                                                                                                                                      |
-| SEV_64BIT          | AMD SEV guest execution only allowed from a 64-bit host                                                                                                                            |
-| SEV_ALTERNATIVE    | AMD SEV Alternate Injection supported                                                                                                                                              |
-| SEV_DEBUGSWAP      | Full debug state swap supported for SEV-ES guests                                                                                                                                  |
-| SEV_ES             | AMD SEV Encrypted State supported                                                                                                                                                  |
-| SEV_RESTRICTED     | AMD SEV Restricted Injection supported                                                                                                                                             |
-| SEV_SNP            | AMD SEV Secure Nested Paging supported                                                                                                                                             |
-| SGX                | Software Guard Extensions                                                                                                                                                          |
-| SGXLC              | Software Guard Extensions Launch Control                                                                                                                                           |
-| SGXPQC             | Software Guard Extensions 256-bit Encryption                                                                                                                                       |
-| SHA                | Intel SHA Extensions                                                                                                                                                               |
-| SME                | AMD Secure Memory Encryption supported                                                                                                                                             |
-| SME_COHERENT       | AMD Hardware cache coherency across encryption domains enforced                                                                                                                    |
-| SM3_X86            | SM3 instructions                                                                                                                                                                   |
-| SM4_X86            | SM4 instructions                                                                                                                                                                   |
-| SPEC_CTRL_SSBD     | Speculative Store Bypass Disable                                                                                                                                                   |
-| SRBDS_CTRL         | SRBDS mitigation MSR available                                                                                                                                                     |
-| SSE                | SSE functions                                                                                                                                                                      |
-| SSE2               | P4 SSE functions                                                                                                                                                                   |
-| SSE3               | Prescott SSE3 functions                                                                                                                                                            |
-| SSE4               | Penryn SSE4.1 functions                                                                                                                                                            |
-| SSE42              | Nehalem SSE4.2 functions                                                                                                                                                           |
-| SSE4A              | AMD Barcelona microarchitecture SSE4a instructions                                                                                                                                 |
-| SSSE3              | Conroe SSSE3 functions                                                                                                                                                             |
-| STIBP              | Single Thread Indirect Branch Predictors                                                                                                                                           |
-| STIBP_ALWAYSON     | AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On                                                                              |
-| STOSB_SHORT        | Fast short STOSB                                                                                                                                                                   |
-| SUCCOR             | Software uncorrectable error containment and recovery capability.                                                                                                                  |
-| SVM                | AMD Secure Virtual Machine                                                                                                                                                         |
-| SVMDA              | Indicates support for the SVM decode assists.                                                                                                                                      |
-| SVMFBASID          | SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control |
-| SVML               | AMD SVM lock. Indicates support for SVM-Lock.                                                                                                                                      |
-| SVMNP              | AMD SVM nested paging                                                                                                                                                              |
-| SVMPF              | SVM pause intercept filter. Indicates support for the pause intercept filter                                                                                                       |
-| SVMPFT             | SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold                                                                                           |
-| SYSCALL            | System-Call Extension (SCE): SYSCALL and SYSRET instructions.                                                                                                                      |
-| SYSEE              | SYSENTER and SYSEXIT instructions                                                                                                                                                  |
-| TBM                | AMD Trailing Bit Manipulation                                                                                                                                                      |
-| TDX_GUEST          | Intel Trust Domain Extensions Guest                                                                                                                                                |
-| TLB_FLUSH_NESTED   | AMD: Flushing includes all the nested translations for guest translations                                                                                                          |
-| TME                | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.                         |
-| TOPEXT             | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.                                                         |
-| TSA_L1_NO          | AMD only: Not vulnerable to TSA-L1                                                                                                                                                 |
-| TSA_SQ_NO          | AMD only: Not vulnerable to TSA-SQ                                                                                                                                                 |
-| TSA_VERW_CLEAR     | AMD: If set, the memory form of the VERW instruction may be used to help mitigate TSA                                                                                              |
-| TSCRATEMSR         | MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104                                                                                                       |
-| TSXLDTRK           | Intel TSX Suspend Load Address Tracking                                                                                                                                            |
-| VAES               | Vector AES. AVX(512) versions requires additional checks.                                                                                                                          |
-| VMCBCLEAN          | VMCB clean bits. Indicates support for VMCB clean bits.                                                                                                                            |
-| VMPL               | AMD VM Permission Levels supported                                                                                                                                                 |
-| VMSA_REGPROT       | AMD VMSA Register Protection supported                                                                                                                                             |
-| VMX                | Virtual Machine Extensions                                                                                                                                                         |
-| VPCLMULQDQ         | Carry-Less Multiplication Quadword. Requires AVX for 3 register versions.                                                                                                          |
-| VTE                | AMD Virtual Transparent Encryption supported                                                                                                                                       |
-| WAITPKG            | TPAUSE, UMONITOR, UMWAIT                                                                                                                                                           |
-| WBNOINVD           | Write Back and Do Not Invalidate Cache                                                                                                                                             |
-| WRMSRNS            | Non-Serializing Write to Model Specific Register                                                                                                                                   |
-| X87                | FPU                                                                                                                                                                                |
-| XGETBV1            | Supports XGETBV with ECX = 1                                                                                                                                                       |
-| XOP                | Bulldozer XOP functions                                                                                                                                                            |
-| XSAVE              | XSAVE, XRESTOR, XSETBV, XGETBV                                                                                                                                                     |
-| XSAVEC             | Supports XSAVEC and the compacted form of XRSTOR.                                                                                                                                  |
-| XSAVEOPT           | XSAVEOPT available                                                                                                                                                                 |
-| XSAVES             | Supports XSAVES/XRSTORS and IA32_XSS                                                                                                                                               |
-
-# ARM features:
-
-| Feature Flag | Description                                                      |
-|--------------|------------------------------------------------------------------|
-| AESARM       | AES instructions                                                 |
-| ARMCPUID     | Some CPU ID registers readable at user-level                     |
-| ASIMD        | Advanced SIMD                                                    |
-| ASIMDDP      | SIMD Dot Product                                                 |
-| ASIMDHP      | Advanced SIMD half-precision floating point                      |
-| ASIMDRDM     | Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) |
-| ATOMICS      | Large System Extensions (LSE)                                    |
-| CRC32        | CRC32/CRC32C instructions                                        |
-| DCPOP        | Data cache clean to Point of Persistence (DC CVAP)               |
-| EVTSTRM      | Generic timer                                                    |
-| FCMA         | Floatin point complex number addition and multiplication         |
-| FHM          | FMLAL and FMLSL instructions                                     |
-| FP           | Single-precision and double-precision floating point             |
-| FPHP         | Half-precision floating point                                    |
-| GPA          | Generic Pointer Authentication                                   |
-| JSCVT        | Javascript-style double->int convert (FJCVTZS)                   |
-| LRCPC        | Weaker release consistency (LDAPR, etc)                          |
-| PMULL        | Polynomial Multiply instructions (PMULL/PMULL2)                  |
-| RNDR         | Random Number instructions                                       |
-| TLB          | Outer Shareable and TLB range maintenance instructions           |
-| TS           | Flag manipulation instructions                                   |
-| SHA1         | SHA-1 instructions (SHA1C, etc)                                  |
-| SHA2         | SHA-2 instructions (SHA256H, etc)                                |
-| SHA3         | SHA-3 instructions (EOR3, RAXI, XAR, BCAX)                       |
-| SHA512       | SHA512 instructions                                              |
-| SM3          | SM3 instructions                                                 |
-| SM4          | SM4 instructions                                                 |
-| SVE          | Scalable Vector Extension                                        |
-
-# license
-
-This code is published under an MIT license. See LICENSE file for more information.
@@ -1,47 +0,0 @@
-// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
-
-//+build 386,!gccgo,!noasm,!appengine
-
-// func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32)
-TEXT ·asmCpuid(SB), 7, $0
-	XORL CX, CX
-	MOVL op+0(FP), AX
-	CPUID
-	MOVL AX, eax+4(FP)
-	MOVL BX, ebx+8(FP)
-	MOVL CX, ecx+12(FP)
-	MOVL DX, edx+16(FP)
-	RET
-
-// func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32)
-TEXT ·asmCpuidex(SB), 7, $0
-	MOVL op+0(FP), AX
-	MOVL op2+4(FP), CX
-	CPUID
-	MOVL AX, eax+8(FP)
-	MOVL BX, ebx+12(FP)
-	MOVL CX, ecx+16(FP)
-	MOVL DX, edx+20(FP)
-	RET
-
-// func xgetbv(index uint32) (eax, edx uint32)
-TEXT ·asmXgetbv(SB), 7, $0
-	MOVL index+0(FP), CX
-	BYTE $0x0f; BYTE $0x01; BYTE $0xd0 // XGETBV
-	MOVL AX, eax+4(FP)
-	MOVL DX, edx+8(FP)
-	RET
-
-// func asmRdtscpAsm() (eax, ebx, ecx, edx uint32)
-TEXT ·asmRdtscpAsm(SB), 7, $0
-	BYTE $0x0F; BYTE $0x01; BYTE $0xF9 // RDTSCP
-	MOVL AX, eax+0(FP)
-	MOVL BX, ebx+4(FP)
-	MOVL CX, ecx+8(FP)
-	MOVL DX, edx+12(FP)
-	RET
-
-// func asmDarwinHasAVX512() bool
-TEXT ·asmDarwinHasAVX512(SB), 7, $0
-	MOVL $0, eax+0(FP)
-	RET
@@ -1,72 +0,0 @@
-// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
-
-//+build amd64,!gccgo,!noasm,!appengine
-
-// func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32)
-TEXT ·asmCpuid(SB), 7, $0
-	XORQ CX, CX
-	MOVL op+0(FP), AX
-	CPUID
-	MOVL AX, eax+8(FP)
-	MOVL BX, ebx+12(FP)
-	MOVL CX, ecx+16(FP)
-	MOVL DX, edx+20(FP)
-	RET
-
-// func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32)
-TEXT ·asmCpuidex(SB), 7, $0
-	MOVL op+0(FP), AX
-	MOVL op2+4(FP), CX
-	CPUID
-	MOVL AX, eax+8(FP)
-	MOVL BX, ebx+12(FP)
-	MOVL CX, ecx+16(FP)
-	MOVL DX, edx+20(FP)
-	RET
-
-// func asmXgetbv(index uint32) (eax, edx uint32)
-TEXT ·asmXgetbv(SB), 7, $0
-	MOVL index+0(FP), CX
-	BYTE $0x0f; BYTE $0x01; BYTE $0xd0 // XGETBV
-	MOVL AX, eax+8(FP)
-	MOVL DX, edx+12(FP)
-	RET
-
-// func asmRdtscpAsm() (eax, ebx, ecx, edx uint32)
-TEXT ·asmRdtscpAsm(SB), 7, $0
-	BYTE $0x0F; BYTE $0x01; BYTE $0xF9 // RDTSCP
-	MOVL AX, eax+0(FP)
-	MOVL BX, ebx+4(FP)
-	MOVL CX, ecx+8(FP)
-	MOVL DX, edx+12(FP)
-	RET
-
-// From https://go-review.googlesource.com/c/sys/+/285572/
-// func asmDarwinHasAVX512() bool
-TEXT ·asmDarwinHasAVX512(SB), 7, $0-1
-	MOVB $0, ret+0(FP) // default to false
-
-#ifdef GOOS_darwin // return if not darwin
-#ifdef GOARCH_amd64 // return if not amd64
-// These values from:
-// https://github.com/apple/darwin-xnu/blob/xnu-4570.1.46/osfmk/i386/cpu_capabilities.h
-#define commpage64_base_address         0x00007fffffe00000
-#define commpage64_cpu_capabilities64   (commpage64_base_address+0x010)
-#define commpage64_version              (commpage64_base_address+0x01E)
-#define hasAVX512F                      0x0000004000000000
-	MOVQ $commpage64_version, BX
-	MOVW (BX), AX
-	CMPW AX, $13                            // versions < 13 do not support AVX512
-	JL   no_avx512
-	MOVQ $commpage64_cpu_capabilities64, BX
-	MOVQ (BX), AX
-	MOVQ $hasAVX512F, CX
-	ANDQ CX, AX
-	JZ   no_avx512
-	MOVB $1, ret+0(FP)
-
-no_avx512:
-#endif
-#endif
-	RET
-
@@ -1,36 +0,0 @@
-// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
-
-//+build arm64,!gccgo,!noasm,!appengine
-
-// See https://www.kernel.org/doc/Documentation/arm64/cpu-feature-registers.txt
-
-// func getMidr
-TEXT ·getMidr(SB), 7, $0
-	WORD $0xd5380000    // mrs x0, midr_el1         /* Main ID Register */
-	MOVD R0, midr+0(FP)
-	RET
-
-// func getProcFeatures
-TEXT ·getProcFeatures(SB), 7, $0
-	WORD $0xd5380400            // mrs x0, id_aa64pfr0_el1  /* Processor Feature Register 0 */
-	MOVD R0, procFeatures+0(FP)
-	RET
-
-// func getInstAttributes
-TEXT ·getInstAttributes(SB), 7, $0
-	WORD $0xd5380600            // mrs x0, id_aa64isar0_el1 /* Instruction Set Attribute Register 0 */
-	WORD $0xd5380621            // mrs x1, id_aa64isar1_el1 /* Instruction Set Attribute Register 1 */
-	MOVD R0, instAttrReg0+0(FP)
-	MOVD R1, instAttrReg1+8(FP)
-	RET
-
-TEXT ·getVectorLength(SB), 7, $0
-	WORD $0xd2800002  // mov   x2, #0
-	WORD $0x04225022  // addvl x2, x2, #1
-	WORD $0xd37df042  // lsl   x2, x2, #3
-	WORD $0xd2800003  // mov   x3, #0
-	WORD $0x04635023  // addpl x3, x3, #1
-	WORD $0xd37df063  // lsl   x3, x3, #3
-	MOVD R2, vl+0(FP)
-	MOVD R3, pl+8(FP)
-	RET
@@ -1,250 +0,0 @@
-// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
-
-//go:build arm64 && !gccgo && !noasm && !appengine
-// +build arm64,!gccgo,!noasm,!appengine
-
-package cpuid
-
-import "runtime"
-
-func getMidr() (midr uint64)
-func getProcFeatures() (procFeatures uint64)
-func getInstAttributes() (instAttrReg0, instAttrReg1 uint64)
-func getVectorLength() (vl, pl uint64)
-
-func initCPU() {
-	cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 }
-	cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 }
-	xgetbv = func(uint32) (a, b uint32) { return 0, 0 }
-	rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 }
-}
-
-func addInfo(c *CPUInfo, safe bool) {
-	// Seems to be safe to assume on ARM64
-	c.CacheLine = 64
-	detectOS(c)
-
-	// ARM64 disabled since it may crash if interrupt is not intercepted by OS.
-	if safe && !c.Has(ARMCPUID) && runtime.GOOS != "freebsd" {
-		return
-	}
-	midr := getMidr()
-
-	// MIDR_EL1 - Main ID Register
-	// https://developer.arm.com/docs/ddi0595/h/aarch64-system-registers/midr_el1
-	//  x--------------------------------------------------x
-	//  | Name                         |  bits   | visible |
-	//  |--------------------------------------------------|
-	//  | Implementer                  | [31-24] |    y    |
-	//  |--------------------------------------------------|
-	//  | Variant                      | [23-20] |    y    |
-	//  |--------------------------------------------------|
-	//  | Architecture                 | [19-16] |    y    |
-	//  |--------------------------------------------------|
-	//  | PartNum                      | [15-4]  |    y    |
-	//  |--------------------------------------------------|
-	//  | Revision                     | [3-0]   |    y    |
-	//  x--------------------------------------------------x
-
-	switch (midr >> 24) & 0xff {
-	case 0xC0:
-		c.VendorString = "Ampere Computing"
-		c.VendorID = Ampere
-	case 0x41:
-		c.VendorString = "Arm Limited"
-		c.VendorID = ARM
-	case 0x42:
-		c.VendorString = "Broadcom Corporation"
-		c.VendorID = Broadcom
-	case 0x43:
-		c.VendorString = "Cavium Inc"
-		c.VendorID = Cavium
-	case 0x44:
-		c.VendorString = "Digital Equipment Corporation"
-		c.VendorID = DEC
-	case 0x46:
-		c.VendorString = "Fujitsu Ltd"
-		c.VendorID = Fujitsu
-	case 0x49:
-		c.VendorString = "Infineon Technologies AG"
-		c.VendorID = Infineon
-	case 0x4D:
-		c.VendorString = "Motorola or Freescale Semiconductor Inc"
-		c.VendorID = Motorola
-	case 0x4E:
-		c.VendorString = "NVIDIA Corporation"
-		c.VendorID = NVIDIA
-	case 0x50:
-		c.VendorString = "Applied Micro Circuits Corporation"
-		c.VendorID = AMCC
-	case 0x51:
-		c.VendorString = "Qualcomm Inc"
-		c.VendorID = Qualcomm
-	case 0x56:
-		c.VendorString = "Marvell International Ltd"
-		c.VendorID = Marvell
-	case 0x69:
-		c.VendorString = "Intel Corporation"
-		c.VendorID = Intel
-	}
-
-	// Lower 4 bits: Architecture
-	// Architecture	Meaning
-	// 0b0001		Armv4.
-	// 0b0010		Armv4T.
-	// 0b0011		Armv5 (obsolete).
-	// 0b0100		Armv5T.
-	// 0b0101		Armv5TE.
-	// 0b0110		Armv5TEJ.
-	// 0b0111		Armv6.
-	// 0b1111		Architectural features are individually identified in the ID_* registers, see 'ID registers'.
-	// Upper 4 bit: Variant
-	// An IMPLEMENTATION DEFINED variant number.
-	// Typically, this field is used to distinguish between different product variants, or major revisions of a product.
-	c.Family = int(midr>>16) & 0xff
-
-	// PartNum, bits [15:4]
-	// An IMPLEMENTATION DEFINED primary part number for the device.
-	// On processors implemented by Arm, if the top four bits of the primary
-	// part number are 0x0 or 0x7, the variant and architecture are encoded differently.
-	// Revision, bits [3:0]
-	// An IMPLEMENTATION DEFINED revision number for the device.
-	c.Model = int(midr) & 0xffff
-
-	procFeatures := getProcFeatures()
-
-	// ID_AA64PFR0_EL1 - Processor Feature Register 0
-	// x--------------------------------------------------x
-	// | Name                         |  bits   | visible |
-	// |--------------------------------------------------|
-	// | DIT                          | [51-48] |    y    |
-	// |--------------------------------------------------|
-	// | SVE                          | [35-32] |    y    |
-	// |--------------------------------------------------|
-	// | GIC                          | [27-24] |    n    |
-	// |--------------------------------------------------|
-	// | AdvSIMD                      | [23-20] |    y    |
-	// |--------------------------------------------------|
-	// | FP                           | [19-16] |    y    |
-	// |--------------------------------------------------|
-	// | EL3                          | [15-12] |    n    |
-	// |--------------------------------------------------|
-	// | EL2                          | [11-8]  |    n    |
-	// |--------------------------------------------------|
-	// | EL1                          | [7-4]   |    n    |
-	// |--------------------------------------------------|
-	// | EL0                          | [3-0]   |    n    |
-	// x--------------------------------------------------x
-
-	var f flagSet
-	// if procFeatures&(0xf<<48) != 0 {
-	// 	fmt.Println("DIT")
-	// }
-	f.setIf(procFeatures&(0xf<<32) != 0, SVE)
-	if procFeatures&(0xf<<20) != 15<<20 {
-		f.set(ASIMD)
-		// https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64pfr0_el1
-		// 0b0001 --> As for 0b0000, and also includes support for half-precision floating-point arithmetic.
-		f.setIf(procFeatures&(0xf<<20) == 1<<20, FPHP, ASIMDHP)
-	}
-	f.setIf(procFeatures&(0xf<<16) != 0, FP)
-
-	instAttrReg0, instAttrReg1 := getInstAttributes()
-
-	// https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1
-	//
-	// ID_AA64ISAR0_EL1 - Instruction Set Attribute Register 0
-	// x--------------------------------------------------x
-	// | Name                         |  bits   | visible |
-	// |--------------------------------------------------|
-	// | RNDR                         | [63-60] |    y    |
-	// |--------------------------------------------------|
-	// | TLB                          | [59-56] |    y    |
-	// |--------------------------------------------------|
-	// | TS                           | [55-52] |    y    |
-	// |--------------------------------------------------|
-	// | FHM                          | [51-48] |    y    |
-	// |--------------------------------------------------|
-	// | DP                           | [47-44] |    y    |
-	// |--------------------------------------------------|
-	// | SM4                          | [43-40] |    y    |
-	// |--------------------------------------------------|
-	// | SM3                          | [39-36] |    y    |
-	// |--------------------------------------------------|
-	// | SHA3                         | [35-32] |    y    |
-	// |--------------------------------------------------|
-	// | RDM                          | [31-28] |    y    |
-	// |--------------------------------------------------|
-	// | ATOMICS                      | [23-20] |    y    |
-	// |--------------------------------------------------|
-	// | CRC32                        | [19-16] |    y    |
-	// |--------------------------------------------------|
-	// | SHA2                         | [15-12] |    y    |
-	// |--------------------------------------------------|
-	// | SHA1                         | [11-8]  |    y    |
-	// |--------------------------------------------------|
-	// | AES                          | [7-4]   |    y    |
-	// x--------------------------------------------------x
-
-	f.setIf(instAttrReg0&(0xf<<60) != 0, RNDR)
-	f.setIf(instAttrReg0&(0xf<<56) != 0, TLB)
-	f.setIf(instAttrReg0&(0xf<<52) != 0, TS)
-	f.setIf(instAttrReg0&(0xf<<48) != 0, FHM)
-	f.setIf(instAttrReg0&(0xf<<44) != 0, ASIMDDP)
-	f.setIf(instAttrReg0&(0xf<<40) != 0, SM4)
-	f.setIf(instAttrReg0&(0xf<<36) != 0, SM3)
-	f.setIf(instAttrReg0&(0xf<<32) != 0, SHA3)
-	f.setIf(instAttrReg0&(0xf<<28) != 0, ASIMDRDM)
-	f.setIf(instAttrReg0&(0xf<<20) != 0, ATOMICS)
-	f.setIf(instAttrReg0&(0xf<<16) != 0, CRC32)
-	f.setIf(instAttrReg0&(0xf<<12) != 0, SHA2)
-	// https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1
-	// 0b0010 --> As 0b0001, plus SHA512H, SHA512H2, SHA512SU0, and SHA512SU1 instructions implemented.
-	f.setIf(instAttrReg0&(0xf<<12) == 2<<12, SHA512)
-	f.setIf(instAttrReg0&(0xf<<8) != 0, SHA1)
-	f.setIf(instAttrReg0&(0xf<<4) != 0, AESARM)
-	// https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1
-	// 0b0010 --> As for 0b0001, plus PMULL/PMULL2 instructions operating on 64-bit data quantities.
-	f.setIf(instAttrReg0&(0xf<<4) == 2<<4, PMULL)
-
-	// https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar1_el1
-	//
-	// ID_AA64ISAR1_EL1 - Instruction set attribute register 1
-	// x--------------------------------------------------x
-	// | Name                         |  bits   | visible |
-	// |--------------------------------------------------|
-	// | GPI                          | [31-28] |    y    |
-	// |--------------------------------------------------|
-	// | GPA                          | [27-24] |    y    |
-	// |--------------------------------------------------|
-	// | LRCPC                        | [23-20] |    y    |
-	// |--------------------------------------------------|
-	// | FCMA                         | [19-16] |    y    |
-	// |--------------------------------------------------|
-	// | JSCVT                        | [15-12] |    y    |
-	// |--------------------------------------------------|
-	// | API                          | [11-8]  |    y    |
-	// |--------------------------------------------------|
-	// | APA                          | [7-4]   |    y    |
-	// |--------------------------------------------------|
-	// | DPB                          | [3-0]   |    y    |
-	// x--------------------------------------------------x
-
-	// if instAttrReg1&(0xf<<28) != 0 {
-	// 	fmt.Println("GPI")
-	// }
-	f.setIf(instAttrReg1&(0xf<<28) != 24, GPA)
-	f.setIf(instAttrReg1&(0xf<<20) != 0, LRCPC)
-	f.setIf(instAttrReg1&(0xf<<16) != 0, FCMA)
-	f.setIf(instAttrReg1&(0xf<<12) != 0, JSCVT)
-	// if instAttrReg1&(0xf<<8) != 0 {
-	// 	fmt.Println("API")
-	// }
-	// if instAttrReg1&(0xf<<4) != 0 {
-	// 	fmt.Println("APA")
-	// }
-	f.setIf(instAttrReg1&(0xf<<0) != 0, DCPOP)
-
-	// Store
-	c.featureSet.or(f)
-}
@@ -1,17 +0,0 @@
-// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
-
-//go:build (!amd64 && !386 && !arm64) || gccgo || noasm || appengine
-// +build !amd64,!386,!arm64 gccgo noasm appengine
-
-package cpuid
-
-func initCPU() {
-	cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 }
-	cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 }
-	xgetbv = func(uint32) (a, b uint32) { return 0, 0 }
-	rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 }
-
-}
-
-func addInfo(info *CPUInfo, safe bool) {}
-func getVectorLength() (vl, pl uint64) { return 0, 0 }
@@ -1,45 +0,0 @@
-// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
-
-//go:build (386 && !gccgo && !noasm && !appengine) || (amd64 && !gccgo && !noasm && !appengine)
-// +build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine
-
-package cpuid
-
-func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32)
-func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32)
-func asmXgetbv(index uint32) (eax, edx uint32)
-func asmRdtscpAsm() (eax, ebx, ecx, edx uint32)
-func asmDarwinHasAVX512() bool
-
-func initCPU() {
-	cpuid = asmCpuid
-	cpuidex = asmCpuidex
-	xgetbv = asmXgetbv
-	rdtscpAsm = asmRdtscpAsm
-	darwinHasAVX512 = asmDarwinHasAVX512
-}
-
-func addInfo(c *CPUInfo, safe bool) {
-	c.maxFunc = maxFunctionID()
-	c.maxExFunc = maxExtendedFunction()
-	c.BrandName = brandName()
-	c.CacheLine = cacheLine()
-	c.Family, c.Model, c.Stepping = familyModel()
-	c.featureSet = support()
-	c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC))
-	c.AMDMemEncryption = hasAMDMemEncryption(c.featureSet.inSet(SME) || c.featureSet.inSet(SEV))
-	c.ThreadsPerCore = threadsPerCore()
-	c.LogicalCores = logicalCores()
-	c.PhysicalCores = physicalCores()
-	c.VendorID, c.VendorString = vendorID()
-	c.HypervisorVendorID, c.HypervisorVendorString = hypervisorVendorID()
-	c.AVX10Level = c.supportAVX10()
-	c.cacheSize()
-	c.frequencies()
-	if c.maxFunc >= 0x0A {
-		eax, ebx, _, edx := cpuid(0x0A)
-		c.PMU = parseLeaf0AH(c, eax, ebx, edx)
-	}
-}
-
-func getVectorLength() (vl, pl uint64) { return 0, 0 }
@@ -1,308 +0,0 @@
-// Code generated by "stringer -type=FeatureID,Vendor"; DO NOT EDIT.
-
-package cpuid
-
-import "strconv"
-
-func _() {
-	// An "invalid array index" compiler error signifies that the constant values have changed.
-	// Re-run the stringer command to generate them again.
-	var x [1]struct{}
-	_ = x[ADX-1]
-	_ = x[AESNI-2]
-	_ = x[AMD3DNOW-3]
-	_ = x[AMD3DNOWEXT-4]
-	_ = x[AMXBF16-5]
-	_ = x[AMXFP16-6]
-	_ = x[AMXINT8-7]
-	_ = x[AMXFP8-8]
-	_ = x[AMXTILE-9]
-	_ = x[AMXTF32-10]
-	_ = x[AMXCOMPLEX-11]
-	_ = x[AMXTRANSPOSE-12]
-	_ = x[APX_F-13]
-	_ = x[AVX-14]
-	_ = x[AVX10-15]
-	_ = x[AVX10_128-16]
-	_ = x[AVX10_256-17]
-	_ = x[AVX10_512-18]
-	_ = x[AVX2-19]
-	_ = x[AVX512BF16-20]
-	_ = x[AVX512BITALG-21]
-	_ = x[AVX512BW-22]
-	_ = x[AVX512CD-23]
-	_ = x[AVX512DQ-24]
-	_ = x[AVX512ER-25]
-	_ = x[AVX512F-26]
-	_ = x[AVX512FP16-27]
-	_ = x[AVX512IFMA-28]
-	_ = x[AVX512PF-29]
-	_ = x[AVX512VBMI-30]
-	_ = x[AVX512VBMI2-31]
-	_ = x[AVX512VL-32]
-	_ = x[AVX512VNNI-33]
-	_ = x[AVX512VP2INTERSECT-34]
-	_ = x[AVX512VPOPCNTDQ-35]
-	_ = x[AVXIFMA-36]
-	_ = x[AVXNECONVERT-37]
-	_ = x[AVXSLOW-38]
-	_ = x[AVXVNNI-39]
-	_ = x[AVXVNNIINT8-40]
-	_ = x[AVXVNNIINT16-41]
-	_ = x[BHI_CTRL-42]
-	_ = x[BMI1-43]
-	_ = x[BMI2-44]
-	_ = x[CETIBT-45]
-	_ = x[CETSS-46]
-	_ = x[CLDEMOTE-47]
-	_ = x[CLMUL-48]
-	_ = x[CLZERO-49]
-	_ = x[CMOV-50]
-	_ = x[CMPCCXADD-51]
-	_ = x[CMPSB_SCADBS_SHORT-52]
-	_ = x[CMPXCHG8-53]
-	_ = x[CPBOOST-54]
-	_ = x[CPPC-55]
-	_ = x[CX16-56]
-	_ = x[EFER_LMSLE_UNS-57]
-	_ = x[ENQCMD-58]
-	_ = x[ERMS-59]
-	_ = x[F16C-60]
-	_ = x[FLUSH_L1D-61]
-	_ = x[FMA3-62]
-	_ = x[FMA4-63]
-	_ = x[FP128-64]
-	_ = x[FP256-65]
-	_ = x[FSRM-66]
-	_ = x[FXSR-67]
-	_ = x[FXSROPT-68]
-	_ = x[GFNI-69]
-	_ = x[HLE-70]
-	_ = x[HRESET-71]
-	_ = x[HTT-72]
-	_ = x[HWA-73]
-	_ = x[HYBRID_CPU-74]
-	_ = x[HYPERVISOR-75]
-	_ = x[IA32_ARCH_CAP-76]
-	_ = x[IA32_CORE_CAP-77]
-	_ = x[IBPB-78]
-	_ = x[IBPB_BRTYPE-79]
-	_ = x[IBRS-80]
-	_ = x[IBRS_PREFERRED-81]
-	_ = x[IBRS_PROVIDES_SMP-82]
-	_ = x[IBS-83]
-	_ = x[IBSBRNTRGT-84]
-	_ = x[IBSFETCHSAM-85]
-	_ = x[IBSFFV-86]
-	_ = x[IBSOPCNT-87]
-	_ = x[IBSOPCNTEXT-88]
-	_ = x[IBSOPSAM-89]
-	_ = x[IBSRDWROPCNT-90]
-	_ = x[IBSRIPINVALIDCHK-91]
-	_ = x[IBS_FETCH_CTLX-92]
-	_ = x[IBS_OPDATA4-93]
-	_ = x[IBS_OPFUSE-94]
-	_ = x[IBS_PREVENTHOST-95]
-	_ = x[IBS_ZEN4-96]
-	_ = x[IDPRED_CTRL-97]
-	_ = x[INT_WBINVD-98]
-	_ = x[INVLPGB-99]
-	_ = x[KEYLOCKER-100]
-	_ = x[KEYLOCKERW-101]
-	_ = x[LAHF-102]
-	_ = x[LAM-103]
-	_ = x[LBRVIRT-104]
-	_ = x[LZCNT-105]
-	_ = x[MCAOVERFLOW-106]
-	_ = x[MCDT_NO-107]
-	_ = x[MCOMMIT-108]
-	_ = x[MD_CLEAR-109]
-	_ = x[MMX-110]
-	_ = x[MMXEXT-111]
-	_ = x[MOVBE-112]
-	_ = x[MOVDIR64B-113]
-	_ = x[MOVDIRI-114]
-	_ = x[MOVSB_ZL-115]
-	_ = x[MOVU-116]
-	_ = x[MPX-117]
-	_ = x[MSRIRC-118]
-	_ = x[MSRLIST-119]
-	_ = x[MSR_PAGEFLUSH-120]
-	_ = x[NRIPS-121]
-	_ = x[NX-122]
-	_ = x[OSXSAVE-123]
-	_ = x[PCONFIG-124]
-	_ = x[POPCNT-125]
-	_ = x[PPIN-126]
-	_ = x[PREFETCHI-127]
-	_ = x[PSFD-128]
-	_ = x[RDPRU-129]
-	_ = x[RDRAND-130]
-	_ = x[RDSEED-131]
-	_ = x[RDTSCP-132]
-	_ = x[RRSBA_CTRL-133]
-	_ = x[RTM-134]
-	_ = x[RTM_ALWAYS_ABORT-135]
-	_ = x[SBPB-136]
-	_ = x[SERIALIZE-137]
-	_ = x[SEV-138]
-	_ = x[SEV_64BIT-139]
-	_ = x[SEV_ALTERNATIVE-140]
-	_ = x[SEV_DEBUGSWAP-141]
-	_ = x[SEV_ES-142]
-	_ = x[SEV_RESTRICTED-143]
-	_ = x[SEV_SNP-144]
-	_ = x[SGX-145]
-	_ = x[SGXLC-146]
-	_ = x[SGXPQC-147]
-	_ = x[SHA-148]
-	_ = x[SME-149]
-	_ = x[SME_COHERENT-150]
-	_ = x[SM3_X86-151]
-	_ = x[SM4_X86-152]
-	_ = x[SPEC_CTRL_SSBD-153]
-	_ = x[SRBDS_CTRL-154]
-	_ = x[SRSO_MSR_FIX-155]
-	_ = x[SRSO_NO-156]
-	_ = x[SRSO_USER_KERNEL_NO-157]
-	_ = x[SSE-158]
-	_ = x[SSE2-159]
-	_ = x[SSE3-160]
-	_ = x[SSE4-161]
-	_ = x[SSE42-162]
-	_ = x[SSE4A-163]
-	_ = x[SSSE3-164]
-	_ = x[STIBP-165]
-	_ = x[STIBP_ALWAYSON-166]
-	_ = x[STOSB_SHORT-167]
-	_ = x[SUCCOR-168]
-	_ = x[SVM-169]
-	_ = x[SVMDA-170]
-	_ = x[SVMFBASID-171]
-	_ = x[SVML-172]
-	_ = x[SVMNP-173]
-	_ = x[SVMPF-174]
-	_ = x[SVMPFT-175]
-	_ = x[SYSCALL-176]
-	_ = x[SYSEE-177]
-	_ = x[TBM-178]
-	_ = x[TDX_GUEST-179]
-	_ = x[TLB_FLUSH_NESTED-180]
-	_ = x[TME-181]
-	_ = x[TOPEXT-182]
-	_ = x[TSA_L1_NO-183]
-	_ = x[TSA_SQ_NO-184]
-	_ = x[TSA_VERW_CLEAR-185]
-	_ = x[TSCRATEMSR-186]
-	_ = x[TSXLDTRK-187]
-	_ = x[VAES-188]
-	_ = x[VMCBCLEAN-189]
-	_ = x[VMPL-190]
-	_ = x[VMSA_REGPROT-191]
-	_ = x[VMX-192]
-	_ = x[VPCLMULQDQ-193]
-	_ = x[VTE-194]
-	_ = x[WAITPKG-195]
-	_ = x[WBNOINVD-196]
-	_ = x[WRMSRNS-197]
-	_ = x[X87-198]
-	_ = x[XGETBV1-199]
-	_ = x[XOP-200]
-	_ = x[XSAVE-201]
-	_ = x[XSAVEC-202]
-	_ = x[XSAVEOPT-203]
-	_ = x[XSAVES-204]
-	_ = x[AESARM-205]
-	_ = x[ARMCPUID-206]
-	_ = x[ASIMD-207]
-	_ = x[ASIMDDP-208]
-	_ = x[ASIMDHP-209]
-	_ = x[ASIMDRDM-210]
-	_ = x[ATOMICS-211]
-	_ = x[CRC32-212]
-	_ = x[DCPOP-213]
-	_ = x[EVTSTRM-214]
-	_ = x[FCMA-215]
-	_ = x[FHM-216]
-	_ = x[FP-217]
-	_ = x[FPHP-218]
-	_ = x[GPA-219]
-	_ = x[JSCVT-220]
-	_ = x[LRCPC-221]
-	_ = x[PMULL-222]
-	_ = x[RNDR-223]
-	_ = x[TLB-224]
-	_ = x[TS-225]
-	_ = x[SHA1-226]
-	_ = x[SHA2-227]
-	_ = x[SHA3-228]
-	_ = x[SHA512-229]
-	_ = x[SM3-230]
-	_ = x[SM4-231]
-	_ = x[SVE-232]
-	_ = x[PMU_FIXEDCOUNTER_CYCLES-233]
-	_ = x[PMU_FIXEDCOUNTER_REFCYCLES-234]
-	_ = x[PMU_FIXEDCOUNTER_INSTRUCTIONS-235]
-	_ = x[PMU_FIXEDCOUNTER_TOPDOWN_SLOTS-236]
-	_ = x[lastID-237]
-	_ = x[firstID-0]
-}
-
-const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAMXTF32AMXCOMPLEXAMXTRANSPOSEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSGXPQCSHASMESME_COHERENTSM3_X86SM4_X86SPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSA_L1_NOTSA_SQ_NOTSA_VERW_CLEARTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFHMFPFPHPGPAJSCVTLRCPCPMULLRNDRTLBTSSHA1SHA2SHA3SHA512SM3SM4SVEPMU_FIXEDCOUNTER_CYCLESPMU_FIXEDCOUNTER_REFCYCLESPMU_FIXEDCOUNTER_INSTRUCTIONSPMU_FIXEDCOUNTER_TOPDOWN_SLOTSlastID"
-
-var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 75, 85, 97, 102, 105, 110, 119, 128, 137, 141, 151, 163, 171, 179, 187, 195, 202, 212, 222, 230, 240, 251, 259, 269, 287, 302, 309, 321, 328, 335, 346, 358, 366, 370, 374, 380, 385, 393, 398, 404, 408, 417, 435, 443, 450, 454, 458, 472, 478, 482, 486, 495, 499, 503, 508, 513, 517, 521, 528, 532, 535, 541, 544, 547, 557, 567, 580, 593, 597, 608, 612, 626, 643, 646, 656, 667, 673, 681, 692, 700, 712, 728, 742, 753, 763, 778, 786, 797, 807, 814, 823, 833, 837, 840, 847, 852, 863, 870, 877, 885, 888, 894, 899, 908, 915, 923, 927, 930, 936, 943, 956, 961, 963, 970, 977, 983, 987, 996, 1000, 1005, 1011, 1017, 1023, 1033, 1036, 1052, 1056, 1065, 1068, 1077, 1092, 1105, 1111, 1125, 1132, 1135, 1140, 1146, 1149, 1152, 1164, 1171, 1178, 1192, 1202, 1214, 1221, 1240, 1243, 1247, 1251, 1255, 1260, 1265, 1270, 1275, 1289, 1300, 1306, 1309, 1314, 1323, 1327, 1332, 1337, 1343, 1350, 1355, 1358, 1367, 1383, 1386, 1392, 1401, 1410, 1424, 1434, 1442, 1446, 1455, 1459, 1471, 1474, 1484, 1487, 1494, 1502, 1509, 1512, 1519, 1522, 1527, 1533, 1541, 1547, 1553, 1561, 1566, 1573, 1580, 1588, 1595, 1600, 1605, 1612, 1616, 1619, 1621, 1625, 1628, 1633, 1638, 1643, 1647, 1650, 1652, 1656, 1660, 1664, 1670, 1673, 1676, 1679, 1702, 1728, 1757, 1787, 1793}
-
-func (i FeatureID) String() string {
-	if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
-		return "FeatureID(" + strconv.FormatInt(int64(i), 10) + ")"
-	}
-	return _FeatureID_name[_FeatureID_index[i]:_FeatureID_index[i+1]]
-}
-func _() {
-	// An "invalid array index" compiler error signifies that the constant values have changed.
-	// Re-run the stringer command to generate them again.
-	var x [1]struct{}
-	_ = x[VendorUnknown-0]
-	_ = x[Intel-1]
-	_ = x[AMD-2]
-	_ = x[VIA-3]
-	_ = x[Transmeta-4]
-	_ = x[NSC-5]
-	_ = x[KVM-6]
-	_ = x[MSVM-7]
-	_ = x[VMware-8]
-	_ = x[XenHVM-9]
-	_ = x[Bhyve-10]
-	_ = x[Hygon-11]
-	_ = x[SiS-12]
-	_ = x[RDC-13]
-	_ = x[Ampere-14]
-	_ = x[ARM-15]
-	_ = x[Broadcom-16]
-	_ = x[Cavium-17]
-	_ = x[DEC-18]
-	_ = x[Fujitsu-19]
-	_ = x[Infineon-20]
-	_ = x[Motorola-21]
-	_ = x[NVIDIA-22]
-	_ = x[AMCC-23]
-	_ = x[Qualcomm-24]
-	_ = x[Marvell-25]
-	_ = x[QEMU-26]
-	_ = x[QNX-27]
-	_ = x[ACRN-28]
-	_ = x[SRE-29]
-	_ = x[Apple-30]
-	_ = x[lastVendor-31]
-}
-
-const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvellQEMUQNXACRNSREApplelastVendor"
-
-var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 149, 152, 156, 159, 164, 174}
-
-func (i Vendor) String() string {
-	if i < 0 || i >= Vendor(len(_Vendor_index)-1) {
-		return "Vendor(" + strconv.FormatInt(int64(i), 10) + ")"
-	}
-	return _Vendor_name[_Vendor_index[i]:_Vendor_index[i+1]]
-}
@@ -1,129 +0,0 @@
-// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file.
-
-package cpuid
-
-import (
-	"runtime"
-	"strings"
-
-	"golang.org/x/sys/unix"
-)
-
-func detectOS(c *CPUInfo) bool {
-	if runtime.GOOS != "ios" {
-		tryToFillCPUInfoFomSysctl(c)
-	}
-	// There are no hw.optional sysctl values for the below features on Mac OS 11.0
-	// to detect their supported state dynamically. Assume the CPU features that
-	// Apple Silicon M1 supports to be available as a minimal set of features
-	// to all Go programs running on darwin/arm64.
-	// TODO: Add more if we know them.
-	c.featureSet.setIf(runtime.GOOS != "ios", AESARM, PMULL, SHA1, SHA2)
-
-	return true
-}
-
-func sysctlGetBool(name string) bool {
-	value, err := unix.SysctlUint32(name)
-	if err != nil {
-		return false
-	}
-	return value != 0
-}
-
-func sysctlGetString(name string) string {
-	value, err := unix.Sysctl(name)
-	if err != nil {
-		return ""
-	}
-	return value
-}
-
-func sysctlGetInt(unknown int, names ...string) int {
-	for _, name := range names {
-		value, err := unix.SysctlUint32(name)
-		if err != nil {
-			continue
-		}
-		if value != 0 {
-			return int(value)
-		}
-	}
-	return unknown
-}
-
-func sysctlGetInt64(unknown int, names ...string) int {
-	for _, name := range names {
-		value64, err := unix.SysctlUint64(name)
-		if err != nil {
-			continue
-		}
-		if int(value64) != unknown {
-			return int(value64)
-		}
-	}
-	return unknown
-}
-
-func setFeature(c *CPUInfo, feature FeatureID, aliases ...string) {
-	for _, alias := range aliases {
-		set := sysctlGetBool(alias)
-		c.featureSet.setIf(set, feature)
-		if set {
-			break
-		}
-	}
-}
-
-func tryToFillCPUInfoFomSysctl(c *CPUInfo) {
-	c.BrandName = sysctlGetString("machdep.cpu.brand_string")
-
-	if len(c.BrandName) != 0 {
-		c.VendorString = strings.Fields(c.BrandName)[0]
-	}
-
-	c.PhysicalCores = sysctlGetInt(runtime.NumCPU(), "hw.physicalcpu")
-	c.ThreadsPerCore = sysctlGetInt(1, "machdep.cpu.thread_count", "kern.num_threads") /
-		sysctlGetInt(1, "hw.physicalcpu")
-	c.LogicalCores = sysctlGetInt(runtime.NumCPU(), "machdep.cpu.core_count")
-	c.Family = sysctlGetInt(0, "machdep.cpu.family", "hw.cpufamily")
-	c.Model = sysctlGetInt(0, "machdep.cpu.model")
-	c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize")
-	c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize")
-	c.Cache.L1D = sysctlGetInt64(-1, "hw.l1dcachesize")
-	c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize")
-	c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize")
-
-	// ARM features:
-	//
-	// Note: On some Apple Silicon system, some feats have aliases. See:
-	// https://developer.apple.com/documentation/kernel/1387446-sysctlbyname/determining_instruction_set_characteristics
-	// When so, we look at all aliases and consider a feature available when at least one identifier matches.
-	setFeature(c, AESARM, "hw.optional.arm.FEAT_AES")                                   // AES instructions
-	setFeature(c, ASIMD, "hw.optional.arm.AdvSIMD", "hw.optional.neon")                 // Advanced SIMD
-	setFeature(c, ASIMDDP, "hw.optional.arm.FEAT_DotProd")                              // SIMD Dot Product
-	setFeature(c, ASIMDHP, "hw.optional.arm.AdvSIMD_HPFPCvt", "hw.optional.neon_hpfp")  // Advanced SIMD half-precision floating point
-	setFeature(c, ASIMDRDM, "hw.optional.arm.FEAT_RDM")                                 // Rounding Double Multiply Accumulate/Subtract
-	setFeature(c, ATOMICS, "hw.optional.arm.FEAT_LSE", "hw.optional.armv8_1_atomics")   // Large System Extensions (LSE)
-	setFeature(c, CRC32, "hw.optional.arm.FEAT_CRC32", "hw.optional.armv8_crc32")       // CRC32/CRC32C instructions
-	setFeature(c, DCPOP, "hw.optional.arm.FEAT_DPB")                                    // Data cache clean to Point of Persistence (DC CVAP)
-	setFeature(c, EVTSTRM, "hw.optional.arm.FEAT_ECV")                                  // Generic timer
-	setFeature(c, FCMA, "hw.optional.arm.FEAT_FCMA", "hw.optional.armv8_3_compnum")     // Floating point complex number addition and multiplication
-	setFeature(c, FHM, "hw.optional.armv8_2_fhm", "hw.optional.arm.FEAT_FHM")           // FMLAL and FMLSL instructions
-	setFeature(c, FP, "hw.optional.floatingpoint")                                      // Single-precision and double-precision floating point
-	setFeature(c, FPHP, "hw.optional.arm.FEAT_FP16", "hw.optional.neon_fp16")           // Half-precision floating point
-	setFeature(c, GPA, "hw.optional.arm.FEAT_PAuth")                                    // Generic Pointer Authentication
-	setFeature(c, JSCVT, "hw.optional.arm.FEAT_JSCVT")                                  // Javascript-style double->int convert (FJCVTZS)
-	setFeature(c, LRCPC, "hw.optional.arm.FEAT_LRCPC")                                  // Weaker release consistency (LDAPR, etc)
-	setFeature(c, PMULL, "hw.optional.arm.FEAT_PMULL")                                  // Polynomial Multiply instructions (PMULL/PMULL2)
-	setFeature(c, RNDR, "hw.optional.arm.FEAT_RNG")                                     // Random Number instructions
-	setFeature(c, TLB, "hw.optional.arm.FEAT_TLBIOS", "hw.optional.arm.FEAT_TLBIRANGE") // Outer Shareable and TLB range maintenance instructions
-	setFeature(c, TS, "hw.optional.arm.FEAT_FlagM", "hw.optional.arm.FEAT_FlagM2")      // Flag manipulation instructions
-	setFeature(c, SHA1, "hw.optional.arm.FEAT_SHA1")                                    // SHA-1 instructions (SHA1C, etc)
-	setFeature(c, SHA2, "hw.optional.arm.FEAT_SHA256")                                  // SHA-2 instructions (SHA256H, etc)
-	setFeature(c, SHA3, "hw.optional.arm.FEAT_SHA3")                                    // SHA-3 instructions (EOR3, RAXI, XAR, BCAX)
-	setFeature(c, SHA512, "hw.optional.arm.FEAT_SHA512")                                // SHA512 instructions
-	setFeature(c, SM3, "hw.optional.arm.FEAT_SM3")                                      // SM3 instructions
-	setFeature(c, SM4, "hw.optional.arm.FEAT_SM4")                                      // SM4 instructions
-	setFeature(c, SVE, "hw.optional.arm.FEAT_SVE")                                      // Scalable Vector Extension
-}
@@ -1,208 +0,0 @@
-// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file.
-
-// Copyright 2018 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file located
-// here https://github.com/golang/sys/blob/master/LICENSE
-
-package cpuid
-
-import (
-	"encoding/binary"
-	"io/ioutil"
-	"runtime"
-)
-
-// HWCAP bits.
-const (
-	hwcap_FP       = 1 << 0
-	hwcap_ASIMD    = 1 << 1
-	hwcap_EVTSTRM  = 1 << 2
-	hwcap_AES      = 1 << 3
-	hwcap_PMULL    = 1 << 4
-	hwcap_SHA1     = 1 << 5
-	hwcap_SHA2     = 1 << 6
-	hwcap_CRC32    = 1 << 7
-	hwcap_ATOMICS  = 1 << 8
-	hwcap_FPHP     = 1 << 9
-	hwcap_ASIMDHP  = 1 << 10
-	hwcap_CPUID    = 1 << 11
-	hwcap_ASIMDRDM = 1 << 12
-	hwcap_JSCVT    = 1 << 13
-	hwcap_FCMA     = 1 << 14
-	hwcap_LRCPC    = 1 << 15
-	hwcap_DCPOP    = 1 << 16
-	hwcap_SHA3     = 1 << 17
-	hwcap_SM3      = 1 << 18
-	hwcap_SM4      = 1 << 19
-	hwcap_ASIMDDP  = 1 << 20
-	hwcap_SHA512   = 1 << 21
-	hwcap_SVE      = 1 << 22
-	hwcap_ASIMDFHM = 1 << 23
-	hwcap_DIT      = 1 << 24
-	hwcap_USCAT    = 1 << 25
-	hwcap_ILRCPC   = 1 << 26
-	hwcap_FLAGM    = 1 << 27
-	hwcap_SSBS     = 1 << 28
-	hwcap_SB       = 1 << 29
-	hwcap_PACA     = 1 << 30
-	hwcap_PACG     = 1 << 31
-	hwcap_GCS      = 1 << 32
-
-	hwcap2_DCPODP      = 1 << 0
-	hwcap2_SVE2        = 1 << 1
-	hwcap2_SVEAES      = 1 << 2
-	hwcap2_SVEPMULL    = 1 << 3
-	hwcap2_SVEBITPERM  = 1 << 4
-	hwcap2_SVESHA3     = 1 << 5
-	hwcap2_SVESM4      = 1 << 6
-	hwcap2_FLAGM2      = 1 << 7
-	hwcap2_FRINT       = 1 << 8
-	hwcap2_SVEI8MM     = 1 << 9
-	hwcap2_SVEF32MM    = 1 << 10
-	hwcap2_SVEF64MM    = 1 << 11
-	hwcap2_SVEBF16     = 1 << 12
-	hwcap2_I8MM        = 1 << 13
-	hwcap2_BF16        = 1 << 14
-	hwcap2_DGH         = 1 << 15
-	hwcap2_RNG         = 1 << 16
-	hwcap2_BTI         = 1 << 17
-	hwcap2_MTE         = 1 << 18
-	hwcap2_ECV         = 1 << 19
-	hwcap2_AFP         = 1 << 20
-	hwcap2_RPRES       = 1 << 21
-	hwcap2_MTE3        = 1 << 22
-	hwcap2_SME         = 1 << 23
-	hwcap2_SME_I16I64  = 1 << 24
-	hwcap2_SME_F64F64  = 1 << 25
-	hwcap2_SME_I8I32   = 1 << 26
-	hwcap2_SME_F16F32  = 1 << 27
-	hwcap2_SME_B16F32  = 1 << 28
-	hwcap2_SME_F32F32  = 1 << 29
-	hwcap2_SME_FA64    = 1 << 30
-	hwcap2_WFXT        = 1 << 31
-	hwcap2_EBF16       = 1 << 32
-	hwcap2_SVE_EBF16   = 1 << 33
-	hwcap2_CSSC        = 1 << 34
-	hwcap2_RPRFM       = 1 << 35
-	hwcap2_SVE2P1      = 1 << 36
-	hwcap2_SME2        = 1 << 37
-	hwcap2_SME2P1      = 1 << 38
-	hwcap2_SME_I16I32  = 1 << 39
-	hwcap2_SME_BI32I32 = 1 << 40
-	hwcap2_SME_B16B16  = 1 << 41
-	hwcap2_SME_F16F16  = 1 << 42
-	hwcap2_MOPS        = 1 << 43
-	hwcap2_HBC         = 1 << 44
-	hwcap2_SVE_B16B16  = 1 << 45
-	hwcap2_LRCPC3      = 1 << 46
-	hwcap2_LSE128      = 1 << 47
-	hwcap2_FPMR        = 1 << 48
-	hwcap2_LUT         = 1 << 49
-	hwcap2_FAMINMAX    = 1 << 50
-	hwcap2_F8CVT       = 1 << 51
-	hwcap2_F8FMA       = 1 << 52
-	hwcap2_F8DP4       = 1 << 53
-	hwcap2_F8DP2       = 1 << 54
-	hwcap2_F8E4M3      = 1 << 55
-	hwcap2_F8E5M2      = 1 << 56
-	hwcap2_SME_LUTV2   = 1 << 57
-	hwcap2_SME_F8F16   = 1 << 58
-	hwcap2_SME_F8F32   = 1 << 59
-	hwcap2_SME_SF8FMA  = 1 << 60
-	hwcap2_SME_SF8DP4  = 1 << 61
-	hwcap2_SME_SF8DP2  = 1 << 62
-	hwcap2_POE         = 1 << 63
-)
-
-func detectOS(c *CPUInfo) bool {
-	// For now assuming no hyperthreading is reasonable.
-	c.LogicalCores = runtime.NumCPU()
-	c.PhysicalCores = c.LogicalCores
-	c.ThreadsPerCore = 1
-	if hwcap == 0 {
-		// We did not get values from the runtime.
-		// Try reading /proc/self/auxv
-
-		// From https://github.com/golang/sys
-		const (
-			_AT_HWCAP  = 16
-			_AT_HWCAP2 = 26
-
-			uintSize = int(32 << (^uint(0) >> 63))
-		)
-
-		buf, err := ioutil.ReadFile("/proc/self/auxv")
-		if err != nil {
-			// e.g. on android /proc/self/auxv is not accessible, so silently
-			// ignore the error and leave Initialized = false. On some
-			// architectures (e.g. arm64) doinit() implements a fallback
-			// readout and will set Initialized = true again.
-			return false
-		}
-		bo := binary.LittleEndian
-		for len(buf) >= 2*(uintSize/8) {
-			var tag, val uint
-			switch uintSize {
-			case 32:
-				tag = uint(bo.Uint32(buf[0:]))
-				val = uint(bo.Uint32(buf[4:]))
-				buf = buf[8:]
-			case 64:
-				tag = uint(bo.Uint64(buf[0:]))
-				val = uint(bo.Uint64(buf[8:]))
-				buf = buf[16:]
-			}
-			switch tag {
-			case _AT_HWCAP:
-				hwcap = val
-			case _AT_HWCAP2:
-				// Not used
-			}
-		}
-		if hwcap == 0 {
-			return false
-		}
-	}
-
-	// HWCap was populated by the runtime from the auxiliary vector.
-	// Use HWCap information since reading aarch64 system registers
-	// is not supported in user space on older linux kernels.
-	c.featureSet.setIf(isSet(hwcap, hwcap_AES), AESARM)
-	c.featureSet.setIf(isSet(hwcap, hwcap_ASIMD), ASIMD)
-	c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDDP), ASIMDDP)
-	c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDHP), ASIMDHP)
-	c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDRDM), ASIMDRDM)
-	c.featureSet.setIf(isSet(hwcap, hwcap_CPUID), ARMCPUID)
-	c.featureSet.setIf(isSet(hwcap, hwcap_CRC32), CRC32)
-	c.featureSet.setIf(isSet(hwcap, hwcap_DCPOP), DCPOP)
-	c.featureSet.setIf(isSet(hwcap, hwcap_EVTSTRM), EVTSTRM)
-	c.featureSet.setIf(isSet(hwcap, hwcap_FCMA), FCMA)
-	c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDFHM), FHM)
-	c.featureSet.setIf(isSet(hwcap, hwcap_FP), FP)
-	c.featureSet.setIf(isSet(hwcap, hwcap_FPHP), FPHP)
-	c.featureSet.setIf(isSet(hwcap, hwcap_JSCVT), JSCVT)
-	c.featureSet.setIf(isSet(hwcap, hwcap_LRCPC), LRCPC)
-	c.featureSet.setIf(isSet(hwcap, hwcap_PMULL), PMULL)
-	c.featureSet.setIf(isSet(hwcap, hwcap2_RNG), RNDR)
-	// c.featureSet.setIf(isSet(hwcap, hwcap_), TLB)
-	// c.featureSet.setIf(isSet(hwcap, hwcap_), TS)
-	c.featureSet.setIf(isSet(hwcap, hwcap_SHA1), SHA1)
-	c.featureSet.setIf(isSet(hwcap, hwcap_SHA2), SHA2)
-	c.featureSet.setIf(isSet(hwcap, hwcap_SHA3), SHA3)
-	c.featureSet.setIf(isSet(hwcap, hwcap_SHA512), SHA512)
-	c.featureSet.setIf(isSet(hwcap, hwcap_SM3), SM3)
-	c.featureSet.setIf(isSet(hwcap, hwcap_SM4), SM4)
-	c.featureSet.setIf(isSet(hwcap, hwcap_SVE), SVE)
-
-	// The Samsung S9+ kernel reports support for atomics, but not all cores
-	// actually support them, resulting in SIGILL. See issue #28431.
-	// TODO(elias.naur): Only disable the optimization on bad chipsets on android.
-	c.featureSet.setIf(isSet(hwcap, hwcap_ATOMICS) && runtime.GOOS != "android", ATOMICS)
-
-	return true
-}
-
-func isSet(hwc uint, value uint) bool {
-	return hwc&value != 0
-}
@@ -1,16 +0,0 @@
-// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file.
-
-//go:build arm64 && !linux && !darwin
-// +build arm64,!linux,!darwin
-
-package cpuid
-
-import "runtime"
-
-func detectOS(c *CPUInfo) bool {
-	c.PhysicalCores = runtime.NumCPU()
-	// For now assuming 1 thread per core...
-	c.ThreadsPerCore = 1
-	c.LogicalCores = c.PhysicalCores
-	return false
-}
@@ -1,8 +0,0 @@
-// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file.
-
-//go:build nounsafe
-// +build nounsafe
-
-package cpuid
-
-var hwcap uint
@@ -1,11 +0,0 @@
-// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file.
-
-//go:build !nounsafe
-// +build !nounsafe
-
-package cpuid
-
-import _ "unsafe" // needed for go:linkname
-
-//go:linkname hwcap internal/cpu.HWCap
-var hwcap uint
@@ -1,15 +0,0 @@
-#!/bin/sh
-
-set -e
-
-go tool dist list | while IFS=/ read os arch; do
-    echo "Checking $os/$arch..."
-    echo " normal"
-    GOARCH=$arch GOOS=$os go build -o /dev/null .
-    echo " noasm"
-    GOARCH=$arch GOOS=$os go build -tags noasm -o /dev/null .
-    echo " appengine"
-    GOARCH=$arch GOOS=$os go build -tags appengine -o /dev/null .
-    echo " noasm,appengine"
-    GOARCH=$arch GOOS=$os go build -tags 'appengine noasm' -o /dev/null .
-done
@@ -1,5 +1,5 @@
-//go:build (appengine || js || nacl || tinygo || wasm) && !windows
-// +build appengine js nacl tinygo wasm
+//go:build (appengine || js || nacl || tinygo || wasm || wasip1 || wasip2) && !windows
+// +build appengine js nacl tinygo wasm wasip1 wasip2
 // +build !windows

 package isatty
@@ -31,6 +31,10 @@ func init() {
 	if procGetFileInformationByHandleEx.Find() != nil {
 		procGetFileInformationByHandleEx = nil
 	}
+	// Check if NtQueryObject is available.
+	if procNtQueryObject.Find() != nil {
+		procNtQueryObject = nil
+	}
 }

 // IsTerminal return true if the file descriptor is terminal.
@@ -43,6 +47,7 @@ func IsTerminal(fd uintptr) bool {
 // Check pipe name is used for cygwin/msys2 pty.
 // Cygwin/MSYS2 PTY has a name like:
 //   \{cygwin,msys}-XXXXXXXXXXXXXXXX-ptyN-{from,to}-master
+// On Windows 7 a trailing suffix (e.g. "-nat") may be appended.
 func isCygwinPipeName(name string) bool {
 	token := strings.Split(name, "-")
 	if len(token) < 5 {
@@ -72,13 +77,19 @@ func isCygwinPipeName(name string) bool {
 		return false
 	}

+	for _, t := range token[5:] {
+		if t == "" {
+			return false
+		}
+	}
+
 	return true
 }

-// getFileNameByHandle use the undocomented ntdll NtQueryObject to get file full name from file handler
+// getFileNameByHandle use the undocumented ntdll NtQueryObject to get file full name from file handler
 // since GetFileInformationByHandleEx is not available under windows Vista and still some old fashion
 // guys are using Windows XP, this is a workaround for those guys, it will also work on system from
-// Windows vista to 10
+// Windows Vista to 10
 // see https://stackoverflow.com/a/18792477 for details
 func getFileNameByHandle(fd uintptr) (string, error) {
 	if procNtQueryObject == nil {
@@ -1,4 +1,4 @@
-FROM golang:1.24@sha256:14fd8a55e59a560704e5fc44970b301d00d344e45d6b914dda228e09f359a088
+FROM golang:1.27@sha256:e0174e51e81218523251d85d248a90d24c3d5e81543b4f07a5d66229397db190

 ENV GOOS=linux
 ENV GOARCH=arm
@@ -1,4 +1,4 @@
-FROM golang:1.24@sha256:14fd8a55e59a560704e5fc44970b301d00d344e45d6b914dda228e09f359a088
+FROM golang:1.27@sha256:e0174e51e81218523251d85d248a90d24c3d5e81543b4f07a5d66229397db190

 ENV GOOS=linux
 ENV GOARCH=arm64
@@ -1,18 +1,35 @@
 FUZZ_TIME ?= 1m
+FUZZ_FLAGS ?=
+
+# The fuzz targets of each package, along with the tags needed to build them.
+FUZZ_TARGETS = ./test/:gofuzz .:sha1cd_asmtest

 export CGO_ENABLED := 1

+# The hashing tests run a second time with SHA-NI off, so that CPUs with it
+# also cover the AVX2 fallback that CPUs without it use.
 .PHONY: test
 test:
-	go test -race -timeout 15s ./...
+	go test -race -timeout 15s -tags sha1cd_asmtest ./...
+	SHA1CD_TEST_NOSHANI=1 go test -race -timeout 15s -tags sha1cd_asmtest ./test/

 .PHONY: bench
 bench:
 	go test -benchmem -run=^$$ -bench ^Benchmark ./...

+# go test only fuzzes a single target per invocation, so each one is run in
+# turn for FUZZ_TIME.
 .PHONY: fuzz
 fuzz:
-	go test -tags gofuzz -fuzz=. -fuzztime=$(FUZZ_TIME) ./test/
+	@set -e; for entry in $(FUZZ_TARGETS); do \
+		pkg="$${entry%%:*}"; tags="$${entry##*:}"; \
+		listed="$$(go test -tags "$$tags" -list '^Fuzz' "$$pkg")"; \
+		for target in $$(echo "$$listed" | grep '^Fuzz'); do \
+			echo "fuzzing $$target in $$pkg for $(FUZZ_TIME)"; \
+			go test $(FUZZ_FLAGS) -tags "$$tags" -run '^$$' -fuzz "^$$target"'$$' \
+				-fuzztime=$(FUZZ_TIME) "$$pkg"; \
+		done; \
+	done

 # Cross build project in arm/v7.
 build-arm:
@@ -24,9 +41,11 @@ build-arm64:
 	docker build -t sha1cd-arm64 -f Dockerfile.arm64 .
 	docker run --rm sha1cd-arm64

-# Build with cgo disabled.
+# Build with cgo disabled. Vetting every package (not just ./cgo) is what
+# catches the cgo and non-cgo builds drifting apart in their exported API.
 build-nocgo:
-	CGO_ENABLED=0 go build ./cgo
+	CGO_ENABLED=0 go build ./...
+	CGO_ENABLED=0 go vet ./...

 # Run cross-compilation to assure supported architectures.
 cross-build: build-arm build-arm64 build-nocgo
@@ -0,0 +1,28 @@
+// Package cpu detects the CPU features that sha1cd dispatches on.
+//
+// It covers only what the assembly implementations need, which keeps
+// start up cheap and avoids an external dependency. Every flag is false
+// where a feature cannot be detected safely, which selects the generic
+// implementation.
+package cpu
+
+// X86 holds the features of the current amd64 CPU. All flags are false on
+// other architectures.
+var X86 struct {
+	// HasAVX and HasAVX2 are set only when the OS also preserves the YMM
+	// state, and HasAVX512F only when it preserves the ZMM and opmask state.
+	HasAVX     bool
+	HasAVX2    bool
+	HasAVX512F bool
+	HasBMI1    bool
+	HasBMI2    bool
+	HasSHA     bool
+	HasSSSE3   bool
+	HasSSE41   bool
+}
+
+// ARM64 holds the features of the current arm64 CPU. All flags are false on
+// other architectures.
+var ARM64 struct {
+	HasSHA1 bool
+}
@@ -0,0 +1,63 @@
+//go:build !noasm && gc && amd64
+
+package cpu
+
+// cpuid and xgetbv are implemented in cpu_amd64.s.
+func cpuid(eaxArg, ecxArg uint32) (eax, ebx, ecx, edx uint32)
+func xgetbv() (eax, edx uint32)
+
+func init() {
+	const (
+		// CPUID EAX=1: ECX
+		ssse3   = 1 << 9
+		sse41   = 1 << 19
+		osxsave = 1 << 27
+		avx     = 1 << 28
+
+		// CPUID EAX=7, ECX=0: EBX
+		bmi1    = 1 << 3
+		avx2    = 1 << 5
+		bmi2    = 1 << 8
+		avx512f = 1 << 16
+		sha     = 1 << 29
+
+		// XCR0
+		xmmState      = 1 << 1
+		ymmState      = 1 << 2
+		opmaskState   = 1 << 5
+		zmmHi256State = 1 << 6
+		hi16ZMMState  = 1 << 7
+		zmmState      = opmaskState | zmmHi256State | hi16ZMMState
+	)
+
+	maxID, _, _, _ := cpuid(0, 0)
+	if maxID < 1 {
+		return
+	}
+
+	_, _, ecx1, _ := cpuid(1, 0)
+	X86.HasSSSE3 = ecx1&ssse3 != 0
+	X86.HasSSE41 = ecx1&sse41 != 0
+
+	// VEX encoded instructions also need the OS to preserve the YMM state,
+	// which XGETBV reports once OSXSAVE says it is available.
+	// macOS enables the ZMM state lazily, so XCR0 may not report it and
+	// AVX-512 is then left unused, which is safe.
+	var osYMM, osZMM bool
+	if ecx1&(osxsave|avx) == osxsave|avx {
+		xcr0, _ := xgetbv()
+		osYMM = xcr0&(xmmState|ymmState) == xmmState|ymmState
+		osZMM = osYMM && xcr0&zmmState == zmmState
+	}
+	X86.HasAVX = osYMM
+
+	if maxID < 7 {
+		return
+	}
+	_, ebx7, _, _ := cpuid(7, 0)
+	X86.HasAVX2 = osYMM && ebx7&avx2 != 0
+	X86.HasAVX512F = osZMM && ebx7&avx512f != 0
+	X86.HasBMI1 = ebx7&bmi1 != 0
+	X86.HasBMI2 = ebx7&bmi2 != 0
+	X86.HasSHA = ebx7&sha != 0
+}
@@ -0,0 +1,22 @@
+//go:build !noasm && gc && amd64
+
+#include "textflag.h"
+
+// func cpuid(eaxArg, ecxArg uint32) (eax, ebx, ecx, edx uint32)
+TEXT ·cpuid(SB), NOSPLIT, $0-24
+	MOVL eaxArg+0(FP), AX
+	MOVL ecxArg+4(FP), CX
+	CPUID
+	MOVL AX, eax+8(FP)
+	MOVL BX, ebx+12(FP)
+	MOVL CX, ecx+16(FP)
+	MOVL DX, edx+20(FP)
+	RET
+
+// func xgetbv() (eax, edx uint32)
+TEXT ·xgetbv(SB), NOSPLIT, $0-8
+	MOVL $0, CX
+	XGETBV
+	MOVL AX, eax+0(FP)
+	MOVL DX, edx+4(FP)
+	RET
@@ -0,0 +1,9 @@
+//go:build !noasm && gc && arm64 && darwin
+
+package cpu
+
+// Every Apple arm64 chip implements the ARMv8 Cryptographic Extension. The Go
+// runtime makes the same assumption for crypto/sha1 on darwin/arm64.
+func init() {
+	ARM64.HasSHA1 = true
+}
@@ -0,0 +1,12 @@
+//go:build !noasm && gc && arm64 && freebsd
+
+package cpu
+
+// getisar0 is implemented in cpu_arm64_freebsd.s.
+func getisar0() uint64
+
+// FreeBSD emulates user space reads of ID_AA64ISAR0_EL1. Its SHA1 field, bits
+// [11:8], is non zero when the SHA1 instructions are implemented.
+func init() {
+	ARM64.HasSHA1 = (getisar0()>>8)&0xf != 0
+}
@@ -0,0 +1,9 @@
+//go:build !noasm && gc && arm64 && freebsd
+
+#include "textflag.h"
+
+// func getisar0() uint64
+TEXT ·getisar0(SB), NOSPLIT, $0-8
+	MRS  ID_AA64ISAR0_EL1, R0
+	MOVD R0, ret+0(FP)
+	RET
@@ -0,0 +1,29 @@
+//go:build !noasm && gc && arm64 && linux
+
+package cpu
+
+import (
+	"os"
+	_ "unsafe" // for go:linkname
+)
+
+// runtime_getAuxv returns the auxiliary vector the kernel passed to the
+// process. The runtime keeps it reachable for golang.org/x/sys/cpu and
+// others, see go.dev/issue/57336 and go.dev/issue/67401.
+//
+//go:linkname runtime_getAuxv runtime.getAuxv
+func runtime_getAuxv() []uintptr
+
+// Linux, and so Android, reports the SHA1 instructions through HWCAP, as
+// not every kernel lets user space read the ID registers.
+func init() {
+	hwcap, ok := hwcapFromAuxv(runtime_getAuxv())
+	if !ok {
+		// The procfs copy may not be readable in restricted environments,
+		// in which case the generic implementation is used.
+		if buf, err := os.ReadFile("/proc/self/auxv"); err == nil {
+			hwcap, _ = hwcapFromProcAuxv(buf)
+		}
+	}
+	ARM64.HasSHA1 = hwcap&hwcapSHA1 != 0
+}
--- a/Show More
+++ b/Show More